DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Glb1l3

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001019529.2 Gene:Glb1l3 RGDID:1561462 Length:644 Species:Rattus norvegicus

Alignment Length:634 Identity:216/635 (34%)
Similarity:317/635 (50%) Gaps:88/635 (14%)


  Fly    31 VGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALD 95
            ||||.:|:|          |....|.|:|..|..|.||.||||...|.|:.||..::|.|.|.:.
  Rat    55 VGLSTETNA----------HGQAYFTLEGHKFMIVGGSIHYFRVPREYWKDRLLKLQACGFNTVT 109

  Fly    96 TYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSI 160
            ||:.|:||....|::::..|.|:..::.:|:....::|||||||||||.|.||||.||. :.|..
  Rat   110 TYIPWNLHEQERGKFDFSEILDLEAYVLLAKTLGLWVILRPGPYICAEVDLGGLPSWLL-RNPGS 173

  Fly   161 KMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYV 225
            .:||.:.::|..|.|::..|:|::..|....||.:|.||||||||.:..|.:|:.:::    |.:
  Rat   174 NLRTTNKDFIEAVDKYFDHLIPKILPLQYRRGGPVIAVQVENEYGSFRNDKNYMEYIK----KAL 234

  Fly   226 SGKA---LLFTVDIPNEK-MSCGKIENVFATTDFGIDRINE-IDKIWAMLRALQPTGPLVNSEFY 285
            ..:.   ||.|.|  ||. :..|.::...||.:     :|. |...:..|..:|...|::..|::
  Rat   235 LNRGIVELLLTSD--NESGIRIGSVKGALATIN-----VNSFIKDSFVKLHRMQNDKPIMIMEYW 292

  Fly   286 PGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGI---GYAA 347
            .||...|..::..:...|:...:....||..|.|:|||.|||||||       ::||.   |:..
  Rat   293 TGWYDSWGSKHTEKSANEIRRTIYRFFSYGLSFNVYMFHGGTNFGF-------INGGYHENGHTN 350

  Fly   348 DITSYDYDAVMDEAGGVTTKYNLVKAVI--GEFLPLPEITLNPAKRL----AYGRVELTPKLTLL 406
            .:||||||||:.|||..|.||..::.:.  |...|||     |..||    .|..|.|:..|.|.
  Rat   351 VVTSYDYDAVLSEAGDYTEKYFKLRKLFASGSARPLP-----PLPRLIPKAVYPSVNLSFYLPLF 410

  Fly   407 STEGRAALSKGDPVESIKPKTFEELDLYS------GLVLYETELPSMDLDPALLKIDQINDRAHV 465
            ..  ...|:|  ||....|.|.|.|.:.:      |||||||   |:.....|..  .::|.|.|
  Rat   411 DI--LPYLNK--PVMLETPVTMENLPINNGSGQPFGLVLYET---SICFGGGLSA--SVHDSAQV 466

  Fly   466 FVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGY 528
            |::.:.:|.|....:...:|..:|. ..|::|||||||:||  .|.::.||:...|::   ||..
  Rat   467 FLNDKSIGILDENNEFLHIPKIQGC-QLLRILVENQGRINFSWRIQSEQKGLNEAVTI---NGTL 527

  Fly   529 LPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRI---LRNGPILYTGSLTVTEV-GDTY 589
              |.|:...:..::.|..|..|.            |..||   ...||..|.|||.|... .||:
  Rat   528 --LRNFTIYSLDMKMSFFERLRS------------ASWRIAPKTYKGPAFYWGSLNVGSFPTDTF 578

  Fly   590 LNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILE 638
            |::..|..|..::||.||||||.: |||.|||:|...|...:|.:::.|
  Rat   579 LHLPNWHYGFVFINGRNLGRYWDI-GPQKTLYLPGPWLHPEDNDVIVFE 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 118/332 (36%)
BetaGal_dom4_5 <570..637 CDD:290101 29/68 (43%)
Glb1l3NP_001019529.2 Glyco_hydro_35 69..379 CDD:279624 118/329 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13163782
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.