DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Bin2a

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001009524.1 Gene:Bin2a RGDID:1359233 Length:637 Species:Rattus norvegicus

Alignment Length:662 Identity:213/663 (32%)
Similarity:321/663 (48%) Gaps:98/663 (15%)


  Fly    20 IAVMALTVGLCVGLSGDTDAPEEQPRFTIDH---------------EANTFMLDGQPFRYVSGSF 69
            |..::.|:|:...||.:     :.||....|               :.:.|.|:|.|||.:||:.
  Rat    13 ILCLSSTLGVMAFLSNN-----QLPRLNQSHLTPLWLLTRRVGLKVKDSQFTLEGFPFRIISGAI 72

  Fly    70 HYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIIL 134
            .|||...::||..||.|:|.|.|.|.|::.|:||.|..|.:.:....|:|.|:.:|.|...::||
  Rat    73 DYFRVPRQNWRQSLRKMQARGFNTLTTHIPWNLHEPTMGRFQFIENMDLVAFITMASETGLWVIL 137

  Fly   135 RPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQ 199
            .|||||..:.|.||||.||. |.|.:|:||....:...:.:::..|:||:..|....||.||.||
  Rat   138 CPGPYIGGDIDLGGLPSWLL-KDPKMKLRTTYKGFTKAMNRYFNNLIPRIAQLQYNKGGPIIAVQ 201

  Fly   200 VENEYGDYACDHDYLNWLR--------DETEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFG 256
            ||||||.|..|..|:.:::        ||         ||.|.| ....:..|.::||.||.   
  Rat   202 VENEYGSYYMDKKYMEYVKTALVSRGIDE---------LLMTAD-DGVSLRKGHLQNVLATV--- 253

  Fly   257 IDRINEIDK-IWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNL 320
              |:..|:| .:...:.:|...|::.:.:.......|....|..|.|.:...:|.|.:...|:|.
  Rat   254 --RMKNINKETYEDFKFIQGRSPILMTVYTTNSFDTWGALRQLGDPQMLMKDVREIFNLGFSLNF 316

  Fly   321 YMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAV---IGEFLPL- 381
            |||.||||||...||    ....||...:|||||.|::.|.|..|.:|...:..   :.:|.|| 
  Rat   317 YMFQGGTNFGLIGGA----QSAEGYTPVVTSYDYCALITENGDYTPEYQEFQRFFHSVTDFSPLT 377

  Fly   382 -PEITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYS------GLVL 439
             |:.||.    .||..:.|...:||  .|....|.|  ..:|.:|.:.|:|.:..      |.:|
  Rat   378 RPKATLT----FAYQPLTLLYYMTL--WEVLPYLVK--TTKSSRPLSMEQLTVNGRSGQSFGYIL 434

  Fly   440 YETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSREAQIYSLP---LSKGWGSTLQLLVENQ 501
            |||.:.:..|   |.....|.|||.||:|::.||.|.|..: ..||   |:|. ..||::|||||
  Rat   435 YETTILNGGL---LTSRGHIQDRAQVFLDKDYVGLLDRSNK-ELLPYKDLTKK-TQTLRILVENQ 494

  Fly   502 GRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRREHTD--EKALDPL 562
            ||:..  .::.:.||:.|::.|...     ||..::  .:.||...|.: :||...  :.|..|:
  Rat   495 GRLTSGQDMNKERKGLTGDIYLDKS-----PLRPFK--IYSLEMGNVFI-QREFPKYWKTATSPV 551

  Fly   563 LARQRILRNGPILYTGSLTVTE-VGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEI 626
            :        ||..:...|...: ..||::.:..|||||..:||.:|||||.: |||.|::||...
  Rat   552 M--------GPAFFLSHLKAGDPPQDTFIQVKDWGKGVIAINGRSLGRYWNI-GPQETIFVPGSW 607

  Fly   627 LKVGENSLVILE 638
            |..|.|::::.|
  Rat   608 LHPGVNTIIMFE 619

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 116/334 (35%)
BetaGal_dom4_5 <570..637 CDD:290101 26/68 (38%)
Bin2aNP_001009524.1 AmyAc_family 57..368 CDD:298606 116/331 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13163313
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.