DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Gm1110

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001268404.1 Gene:Gm1110 MGIID:2685956 Length:635 Species:Mus musculus

Alignment Length:690 Identity:212/691 (31%)
Similarity:326/691 (47%) Gaps:113/691 (16%)


  Fly    17 CLIIAVMALTVGLCVGLSGDTDAPEEQPRFT----------IDHEANTFMLDGQPFRYVSGSFHY 71
            ||..|:.|:.:     ||.:..:...|...|          :..:.:.|.|:|.|||.:||:..|
Mouse    13 CLSSALCAMAL-----LSNNEFSRLNQTHLTPLLLINRKVGLQVKDSQFTLEGFPFRIISGTIDY 72

  Fly    72 FRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRP 136
            ||....|||..||.|:|.|.|.|.|::.|:||.|..|::.:....|::.|:.:|.:...::||.|
Mouse    73 FRIPRNSWRLSLRKMQAGGFNTLTTHIPWNLHEPAVGQFYFTENTDLIAFITMASQSGLWVILCP 137

  Fly   137 GPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVE 201
            ||||.::.|.||||.||. |.|.:|:||....:...:.:::..|:|::.......||.||.||||
Mouse   138 GPYIGSDLDLGGLPSWLL-KDPKMKLRTTYKGFTKAMNRYFDNLIPKIAKFQYKKGGPIIAVQVE 201

  Fly   202 NEYGDYACDHDYLNWLR--------DETEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFGID 258
            ||||.|..|..|:.:::        ||         ||.|.| ....:..|.:|||.||.     
Mouse   202 NEYGSYYMDKKYMAYVKTALVSRGIDE---------LLMTAD-DGVSLRKGHLENVLATV----- 251

  Fly   259 RINEIDK-IWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYM 322
            .:..|.| .:..||::|...|::...:.......|...:|..|.|.:...:..:.....|:|.||
Mouse   252 HMKNIKKETFGDLRSIQGKSPILMMVYTTKSFDTWGTLHQTGDAQMLLKDVHEMFHLGFSLNFYM 316

  Fly   323 FFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVIGEF------LPL 381
            |.||||||...||    ....||...:|||||:|::.|.|..|.:|.       ||      :..
Mouse   317 FQGGTNFGLIGGA----QSSEGYKPVVTSYDYNALVSEGGEYTVQYR-------EFQRFFHSVTD 370

  Fly   382 PEITLNP--AKRLAYGRVELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYS------GLV 438
            ..:|:.|  .:..||..|.|...:||  .|....|.|  ..:|.||.:.|:|.:..      |.:
Mouse   371 SHLTVQPKTTQMFAYQPVTLLYFMTL--WEFLPNLVK--TTKSSKPLSMEQLRVNERSGQSFGYI 431

  Fly   439 LYETELPSMDLDPALLKIDQINDRAHVFVDQELVGTLSR---EAQIYSLPLSKGWGSTLQLLVEN 500
            ||||.:.|..|   :.....|.||..||:|...:|.|.:   |..:|. .:||. ...|::||||
Mouse   432 LYETVIFSGGL---ITSRGHIRDRGQVFLDNIYIGLLDQSNSELLLYK-DVSKK-SQILRILVEN 491

  Fly   501 QGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLL 563
            |||:..  .|:.:.||:.|::.|...     ||..::  .:.||.:.:.: :||..:        
Mouse   492 QGRLTSGQDINKERKGLTGDIYLDKS-----PLRPFK--IYSLEMNNIFI-QREFPN-------- 540

  Fly   564 ARQRILR--NGPILYTGSLTVTEVG----DTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYV 622
            :.||:..  .||..:   |:..:.|    ||::.:.||||||..:||.:|||||.: |||.|::|
Mouse   541 SWQRVTSQVQGPAFF---LSYLKAGDPPQDTFMKIQGWGKGVISINGRSLGRYWNI-GPQETVFV 601

  Fly   623 PNEILKVGENSLVILEYQRANKTATGEDLPAVQFDAVAQL 662
            |...|:.|.|.:::.|..:.::        .:.|...|||
Mouse   602 PGSWLQPGVNKIIMFEELKGDE--------KIHFSTKAQL 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 113/331 (34%)
BetaGal_dom4_5 <570..637 CDD:290101 28/73 (38%)
Gm1110NP_001268404.1 AmyAc_family 55..366 CDD:298606 115/338 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13181433
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.