DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Glb1

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001101662.1 Gene:Glb1 RGDID:1597145 Length:647 Species:Rattus norvegicus

Alignment Length:662 Identity:266/663 (40%)
Similarity:380/663 (57%) Gaps:50/663 (8%)


  Fly    17 CLIIAVMALTVGLCVGLSGDTDA--PEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESW 79
            |:::.::||     :.|.|...:  ...|..|.:|::.:.|:.|||||||:|||.||||.....|
  Rat     7 CMLLPLLAL-----LQLLGAAHSFYNVSQRTFELDYKRDRFLKDGQPFRYISGSIHYFRIPRFYW 66

  Fly    80 RSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAER 144
            ..||..|:.:||:|:.|||.|:.|.|..|:|::.|..||..|:::|.:....:|||||||||||.
  Rat    67 EDRLLKMKMAGLDAIQTYVPWNFHEPQPGQYDFSGDRDVEHFIQLAHQLGLLVILRPGPYICAEW 131

  Fly   145 DNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-A 208
            |.||||.||..| .||.:|::||:|::.|.||.|.|:|:::.|...|||.||.||||||||.| |
  Rat   132 DMGGLPAWLLEK-ESIVLRSSDPDYLAAVDKWLAVLLPKMKRLLYQNGGPIITVQVENEYGSYFA 195

  Fly   209 CDHDYLNWLRDETEKYVSGKALLFTVDIPNEK-MSCGKIENVFATTDFGIDRINEIDKIWAMLRA 272
            ||::||.:|......::....:|||.|...|| :.||.:::::||.|||  ....|.:.:.:.|.
  Rat   196 CDYNYLRFLEHRFRYHLGNDIILFTTDGAAEKLLKCGTLQDLYATVDFG--TTGNITRAFLIQRN 258

  Fly   273 LQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANY 337
            .:|.|||:|||||.|||.||.:.:.:.:.:::..:|..:|:|.||||||||.|||||.:..||| 
  Rat   259 FEPKGPLINSEFYTGWLDHWGQPHSKVNTKKLVASLYNLLAYGASVNLYMFIGGTNFAYWNGAN- 322

  Fly   338 NLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVIGEFLPLPEITLNPA-KRLAYGRVELTP 401
                 :.||...|||||||.:.|||.:|.||..|:.||.:|..:||..:.|: .:.|||:|.|..
  Rat   323 -----MPYAPQPTSYDYDAPLSEAGDLTEKYFAVRDVIRKFKEVPEGPIPPSTPKFAYGKVALRK 382

  Fly   402 KLTLLSTEGRAALSKGDPVESIKPKTFEELDLYSGLVLYETELPSMDLDPALL---KIDQINDRA 463
            ..|:  ||....|....||:|:.|.||.::..|.|.|||.|.||....:|..:   .|:.:.|||
  Rat   383 FKTV--TEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYRTTLPQDCSNPKPIFSSPINGVRDRA 445

  Fly   464 HVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNFYIS-NDTKGIFGEVSLQLHNGG 527
            :|.||....|.|.|. ::..|.:....|:||.:||||.||||:..| .|.||:...::|     .
  Rat   446 YVSVDGVPQGILDRN-RMNVLNIRGKAGATLDILVENMGRVNYGNSIKDFKGLISNMTL-----N 504

  Fly   528 YLPLENWRSTAFPLEQSAV---ELWRREHTDEKALDPLLARQRILRNG----PILYTGSLTVTE- 584
            :..|.||  |.|||:..|:   .|...|..||..||    ....||:.    |..|.|:.::.. 
  Rat   505 FTVLTNW--TMFPLDTEALARSHLGNWEAADEGHLD----GHSTLRSSNFTLPTFYVGNFSIPSG 563

  Fly   585 ----VGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKV-GENSLVILEYQRANK 644
                ..||::...||.||..::||||||||||..|||:||:||..||.. ..|::.:||.:.:..
  Rat   564 IPDLPQDTFIQFPGWAKGQVWINGFNLGRYWPTKGPQMTLFVPRNILTTSAPNNITVLELESSPC 628

  Fly   645 TATGEDLPAVQF 656
            :....:|..|:|
  Rat   629 SNGTLELCTVEF 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 153/324 (47%)
BetaGal_dom4_5 <570..637 CDD:290101 30/77 (39%)
Glb1NP_001101662.1 Glyco_hydro_35 41..356 CDD:279624 153/324 (47%)
BetaGal_dom4_5 <553..621 CDD:290101 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13210077
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 513 1.000 Inparanoid score I1232
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T131276
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.