DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Glb1l

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001121001.1 Gene:Glb1l RGDID:1309474 Length:646 Species:Rattus norvegicus

Alignment Length:640 Identity:247/641 (39%)
Similarity:339/641 (53%) Gaps:73/641 (11%)


  Fly    42 EQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPH 106
            |...|.:|.:.:.|:|||.||||:|||.||||.....|..||..|:.|||||:..||.|:.|.|.
  Rat    22 EARSFVVDRQHDRFLLDGVPFRYISGSLHYFRVPRVLWADRLLKMKLSGLNAVQFYVPWNYHEPE 86

  Fly   107 DGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYIS 171
            .|.||:.|..|:..||..|.:.:..:|||||||||||.:.||||.||. :...|.:||:||.::.
  Rat    87 PGIYNFNGSRDLTAFLNEAAKANLLVILRPGPYICAEWEMGGLPSWLL-RNRDIHLRTSDPAFLH 150

  Fly   172 EVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-ACDHDYLNWLRDETEKYVSGKALLFTVD 235
            .|..|:..|:|::......|||.||.:|||||||.| .||..|:..|.......:..:.||||.|
  Rat   151 AVDSWFKVLLPKIYPFLYHNGGNIISIQVENEYGSYKVCDFKYMRHLAGLFRALLGDEILLFTTD 215

  Fly   236 IPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRD 300
            .| :.:.||.::.::||.|||  ..:.:.:|:::||..:|.|||||||:|.|||.:|.:.:..|.
  Rat   216 GP-QGLRCGSLQGLYATVDFG--PADNVTRIFSLLREYEPHGPLVNSEYYTGWLDYWGQNHSTRS 277

  Fly   301 GQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADI-TSYDYDAVMDEAGGV 364
            ...||..|..||...||||:|||.||||||:..||:..     ||...| |||||||.:.|||..
  Rat   278 TPAVARGLERILKLGASVNMYMFHGGTNFGYWNGADDK-----GYFLPITTSYDYDAPISEAGDP 337

  Fly   365 TTKYNLVKAVIGEF--LPL-------PEITLNPAKRLAYGRVELTPKLTLLSTEGRAALSKGDPV 420
            |.|...::.||.:|  :||       |::.|.|......|  .|...|..|..||        |:
  Rat   338 TPKLFAIQNVISKFQEIPLGPLPPPSPKMKLGPLTMSLDG--NLLSFLDFLCPEG--------PI 392

  Fly   421 ESIKPKTFEELDLYSGLVLYETELPSMDLDPALLKI--DQINDRAHVFVDQELVGTLSR--EAQI 481
            .|:.|.|||.:.|..|.:||.|.:.....:|..|.:  :.|:|||:|.||..|.|.|.|  :.::
  Rat   393 HSVLPLTFEAVKLDRGFMLYRTYMTYTVSEPTPLWVPNNGIHDRAYVMVDGVLKGILERSLKEEL 457

  Fly   482 YSLPLSKGWGSTLQLLVENQGRVNFYIS-NDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSA 545
            |   |:...|:.|.:|:||.||::|..: :|.||:.....|     |...|..|  ..|||:...
  Rat   458 Y---LTGKVGTRLDILLENMGRLSFGSNHSDFKGLLEPPLL-----GQTVLTGW--MMFPLKVDK 512

  Fly   546 VELWRREHTDEKALDPLLARQRILRNG---PILYTGSL-TVTEVGDTYLNMAGWGKGVAYVNGFN 606
            :..|         ..||...:|.....   |..|:... .:..:|||:|.:.||.||..::||||
  Rat   513 LVKW---------WIPLQLMKRAQPQAPSVPAFYSAKFPALGLLGDTFLYLPGWTKGQVWINGFN 568

  Fly   607 LGRYWPVAGPQVTLYVPNEILKVGE--NSLVILEYQRANKTATGEDL---PAVQF 656
            |||||.:.|||.|||||..:| .|.  |.:.:||.         ||:   |.:||
  Rat   569 LGRYWTMRGPQQTLYVPRPLL-FGSSINKITLLEL---------EDVPHDPQIQF 613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 147/324 (45%)
BetaGal_dom4_5 <570..637 CDD:290101 30/73 (41%)
Glb1lNP_001121001.1 Glyco_hydro_35 34..349 CDD:279624 147/324 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13178048
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 513 1.000 Inparanoid score I1232
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T131276
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.