DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and GLB1

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001303969.1 Gene:GLB1 HGNCID:4298 Length:725 Species:Homo sapiens

Alignment Length:634 Identity:261/635 (41%)
Similarity:362/635 (57%) Gaps:44/635 (7%)


  Fly    43 QPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHD 107
            |..|.||:..::|:.|||||||:|||.||.|.....|:.||..|:.:||||:.|||.|:.|.|..
Human    77 QRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWP 141

  Fly   108 GEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISE 172
            |:|.:....||..||.:|.|....:|||||||||||.:.||||.||..| .||.:|::||:|::.
Human   142 GQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEK-ESILLRSSDPDYLAA 205

  Fly   173 VGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-ACDHDYLNWLRDETEKYVSGKALLFTVDI 236
            |.||...|:|:::.|...|||.:|.||||||||.| |||.|||.:|:.....::....:|||.|.
Human   206 VDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDG 270

  Fly   237 PNEK-MSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRD 300
            .::. :.||.::.::.|.|||..  :.|...:...|..:|.|||:|||||.|||.||.:.:....
Human   271 AHKTFLKCGALQGLYTTVDFGTG--SNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIK 333

  Fly   301 GQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVT 365
            .:.||::|..||:..||||||||.|||||.:..|||      ..|||..|||||||.:.|||.:|
Human   334 TEAVASSLYDILARGASVNLYMFIGGTNFAYWNGAN------SPYAAQPTSYDYDAPLSEAGDLT 392

  Fly   366 TKYNLVKAVIGEFLPLPEITLNPA-KRLAYGRVELTPKLTLLSTEGRA--ALSKGDPVESIKPKT 427
            .||..::.:|.:|..:||..:.|: .:.|||:|.|..    |.|.|.|  .|....|::|:.|.|
Human   393 EKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEK----LKTVGAALDILCPSGPIKSLYPLT 453

  Fly   428 FEELDLYSGLVLYETELPSMDLDPALLK--IDQINDRAHVFVDQELVGTLSREAQIYSLPLSKGW 490
            |.::..:.|.|||.|.||....:||.|.  ::.::|||:|.||....|.|.|. .:.:|.::...
Human   454 FIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERN-NVITLNITGKA 517

  Fly   491 GSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLE-QSAVEL---- 548
            |:||.|||||.||||:  || ||.||:...::|..:     .|.:|  |.|||: :.||..    
Human   518 GATLDLLVENMGRVNYGAYI-NDFKGLVSNLTLSSN-----ILTDW--TIFPLDTEDAVRSHLGG 574

  Fly   549 WRREHTDEKALDPLLARQRILRNGPILYTGSLTVTE-----VGDTYLNMAGWGKGVAYVNGFNLG 608
            |  .|.|....|...|........|..|.|:.::..     ..||::...||.||..::||||||
Human   575 W--GHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLG 637

  Fly   609 RYWPVAGPQVTLYVPNEILKV-GENSLVILEYQRANKTATGEDLPAVQF 656
            ||||..|||:||:||..||.. ..|::.:||.:.|..::...:|.||.|
Human   638 RYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTF 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 150/324 (46%)
BetaGal_dom4_5 <570..637 CDD:290101 29/73 (40%)
GLB1NP_001303969.1 Glyco_hydro_35 88..402 CDD:279624 149/323 (46%)
BetaGal_dom4_5 <599..667 CDD:290101 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 495 1.000 Inparanoid score I1380
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T130262
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.