DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and bgal-1

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_505849.2 Gene:bgal-1 WormBaseID:WBGene00011832 Length:653 Species:Caenorhabditis elegans

Alignment Length:653 Identity:251/654 (38%)
Similarity:351/654 (54%) Gaps:66/654 (10%)


  Fly    35 GDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVE 99
            ||.:.|.    |.||...|.|:|||.||||:|||.||||...:.|..||..:||.|.||:..|:.
 Worm    35 GDRNIPS----FLIDESKNQFLLDGLPFRYISGSIHYFRIPRDRWDERLGKVRALGFNAIQYYIP 95

  Fly   100 WSLHNPHDGEYNWEGIADVVKFLEIA-QEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMR 163
            |::|...:|.:::.|:.|..:|..:| .:...:.|||.|||||.|.:|||||.||..|..: |.|
 Worm    96 WNMHELEEGNHDFSGLLDFAEFSMMAFHKYGLWTILRVGPYICGELENGGLPWWLLNKNVT-KQR 159

  Fly   164 TNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-ACDHDYLNWLRDETEKYVSG 227
            ::|..:..||..|:..|:||::.|...|||.::|:|:|||||.| |||..||.:|||.|...|..
 Worm   160 SSDRVFTREVENWFEILLPRVKPLLRKNGGPVLMLQIENEYGSYDACDQQYLRFLRDLTRSLVGD 224

  Fly   228 KALLFTVDIPNEK-MSCGKIENVFATTDFG-IDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLT 290
            ..||||.|...|. :.||.:|.||.|.||| .|...||:..:.:.|...|.|||||||:|||||.
 Worm   225 DVLLFTTDGSAESLLKCGTVEGVFPTVDFGPTDDAKEIENNFKLQRKFAPNGPLVNSEYYPGWLV 289

  Fly   291 HWQEQNQRRDG-QEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDY 354
            .|.::.|.... |.:.|..:|:.|..||.|.||..|||||||..||...       |..||||||
 Worm   290 LWGQKKQNLPSPQTIINGSQTMYSLGASFNYYMIHGGTNFGFWNGAETE-------APCITSYDY 347

  Fly   355 DAVMDEAGGVTTKYNLVKAVIGEFL--PLPEITL---NPAKRLAYGRVEL-----TPKLTLLSTE 409
            ||.:.|:|.|||||..::..|....  |.|.:.:   :|..|  :|::::     ..||..|::.
 Worm   348 DAPISESGDVTTKYLEIRKWIKGLTDWPTPPLDVPGNSPKGR--FGKIKMRLVHSVEKLKTLTSL 410

  Fly   410 GRAALSKGDPVESIKPKTFEELDLYSGLVLYETELPSMDLDPALLKIDQINDRAHVFVDQELVGT 474
            |    ..||.||:.||.:||.|....|||.|:.::.|.    ..|.|....|..||:::.:.:.|
 Worm   411 G----DPGDCVETDKPISFETLKHPLGLVAYQAKINSC----GNLTIPSFGDFVHVYLNGKYIDT 467

  Fly   475 LSREAQIYSLPLS--------KGWGSTLQLLVENQGRVNFYISNDTKGIFGEVSLQLHNGGYLPL 531
            |:|  :.|:|..:        :...:.|.:|||||||..|...||.|||..:|.:   ||..:..
 Worm   468 LTR--RYYNLTRNSVIIEGCLENEENRLFMLVENQGRKTFETINDRKGILSDVFM---NGQAIQF 527

  Fly   532 ENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVGDTYLNMAGWG 596
            ........||::   :.:.|:.........:.:.|   :.|  ::.|.|:|....||:|:..|||
 Worm   528 WTQCGIKLPLQE---DFYFRKAMRNNYRKNVKSNQ---KQG--VFIGILSVDAPTDTWLDTTGWG 584

  Fly   597 KGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRANKTATGE--------DLPA 653
            ||:|.|||.|.|||||..|||:|||:|.|.||:||||::::|.:.|.:..|..        |.|.
 Worm   585 KGIAIVNGRNFGRYWPTKGPQMTLYIPAEFLKIGENSVMMVELEGAEEACTSTSSCIADFIDHPV 649

  Fly   654 VQF 656
            ..|
 Worm   650 FDF 652

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 148/327 (45%)
BetaGal_dom4_5 <570..637 CDD:290101 36/67 (54%)
bgal-1NP_505849.2 Glyco_hydro_35 50..369 CDD:279624 148/327 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C12037953
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 412 1.000 Inparanoid score I1031
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T98046
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.