DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and bgal-2

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_509140.2 Gene:bgal-2 WormBaseID:WBGene00019225 Length:642 Species:Caenorhabditis elegans

Alignment Length:672 Identity:210/673 (31%)
Similarity:322/673 (48%) Gaps:96/673 (14%)


  Fly    18 LIIAVMALTVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSR 82
            |:.:|.|...|        ||:   .|.|.||...:.|:|||.||.|::|..||||...:.|..|
 Worm     9 LVCSVFATVFG--------TDS---SPSFKIDTVNSQFLLDGDPFTYIAGEIHYFRIPHQKWDDR 62

  Fly    83 LRTMRASGLNALDTYVEWSLHNPHDGEYN-WEGIADVVKFLEIAQEEDFYIILRPGPYICAERDN 146
            |:.:||.|.||:...|.|:||..:..|.. ..|..|:|||::.|:....|.|||.||||.||.||
 Worm    63 LKRVRALGFNAITVPVPWNLHQFYQDETPILSGNLDLVKFIKAAESNGLYTILRIGPYISAEWDN 127

  Fly   147 GGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDYA-CD 210
            ||||.||.......|.|::||::::||.:|:..|:|::..|...|.|.::|||:|:.||... ||
 Worm   128 GGLPWWLIRNTKIGKYRSSDPSFMTEVTQWWKHLLPKIYPLMRKNAGPVLMVQIEHFYGALGICD 192

  Fly   211 HDYLNWLRDETEKYVSGKALLFTVDIP-NEKMSCGKIENVFATTDFGIDRIN--EIDKIWAMLRA 272
            ..||..|.:..::.:....:||||:.| .:.|.||.:.|:..|.:. :...|  ||:..::|.:|
 Worm   193 QQYLLQLANMAKENLGNDVVLFTVNPPVLQFMRCGTLPNILPTIEI-VPNANAGEIESWFSMQKA 256

  Fly   273 LQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVAN---------ALRTILSYNASVNLYMFFGGTN 328
            .....|.|.|:|.......|        |:.|::         ..:|..:.|||::.:|..||||
 Worm   257 FMQGAPAVASQFLINPFKLW--------GKNVSDPYPNNLIIQTAKTAFALNASLSFHMTHGGTN 313

  Fly   329 FGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKY----NLVKAVIGEFLPLPEITLNPA 389
            ||:..||       :......||||..|.:.|||.|...|    |.:..:.|...|...|..| .
 Worm   314 FGYWNGA-------VDPYPVTTSYDSFAPISEAGDVNPLYISIRNWISNIPGWQNPPTPIPAN-L 370

  Fly   390 KRLAYGRVELTPKLTLLSTEGRAALSKGDPVESI--KPKTFEELDLYSGLVLYETELPSMDLDPA 452
            .|.||..|:    ||:..|.....:.......|.  .|:|.|.:....|.:.|.|.:    ::..
 Worm   371 PRTAYPDVQ----LTVFDTISGFIIGANPECWSSPETPRTAEYIRQGYGYIYYNTTI----IECG 427

  Fly   453 LLKIDQINDRAHVFVDQELVGTLSREAQIYSLPLSKGWGS----------------TLQLLVENQ 501
            .|.|....|.|::|::|..||.|.::           :||                :|::::|..
 Worm   428 SLYIPTFADNAYIFLNQNFVGALYKQ-----------FGSIHNNTIDVQGCLDQFNSLEIIIEIT 481

  Fly   502 GRVNFYISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWR-----REHTDEKALDP 561
            ||.:......::||.|.|.::     .:.||||.|...|:|...:.|.:     ::|..| .:|.
 Worm   482 GRDHNNYPVMSRGIQGNVYMR-----NITLENWESCEVPIETYEISLVKNYESLKQHVFE-TIDF 540

  Fly   562 LLARQRILRNGPILYTGSLTV-TEVGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNE 625
            ..::...:.. |.::.|:|.: |...||:|:..||||||..:|.:|:||||...|||.|||:|:|
 Worm   541 EKSQSAAIEQ-PSVFIGNLIIKTAPADTFLDTRGWGKGVVTINQYNIGRYWASIGPQQTLYIPSE 604

  Fly   626 ILKVGENSLVILEYQRANKTAT 647
            .|..|||.::..|::.|....|
 Worm   605 FLHKGENLIMFYEFEGATTACT 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 118/340 (35%)
BetaGal_dom4_5 <570..637 CDD:290101 31/68 (46%)
bgal-2NP_509140.2 Glyco_hydro_35 34..354 CDD:279624 118/336 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C12037937
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 412 1.000 Inparanoid score I1031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T98046
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.