DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Glb1

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_033882.1 Gene:Glb1 MGIID:88151 Length:647 Species:Mus musculus

Alignment Length:664 Identity:269/665 (40%)
Similarity:370/665 (56%) Gaps:54/665 (8%)


  Fly    17 CLIIAVMAL--TVGLCVGLSGDTDAPEEQPRFTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESW 79
            |..:.::||  .:|...|:...|     |..|.:|:..:.|:.|||||||:|||.||||.....|
Mouse     7 CTPLPLLALLQLLGAAHGIYNVT-----QRTFKLDYSRDRFLKDGQPFRYISGSIHYFRIPRFYW 66

  Fly    80 RSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAER 144
            ..||..|:.:||||:..||.|:.|.|..|:|.:.|..||..|:::|.|....:|||||||||||.
Mouse    67 EDRLLKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVILRPGPYICAEW 131

  Fly   145 DNGGLPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-A 208
            |.||||.||..| .||.:|::||:|:..|.||.|.|:|:::.|...|||.||.||||||||.| |
Mouse   132 DMGGLPAWLLEK-QSIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGPIITVQVENEYGSYFA 195

  Fly   209 CDHDYLNWLRDETEKYVSGKALLFTVDIPNEKM-SCGKIENVFATTDFGIDRINEIDKIWAMLRA 272
            ||:|||.:|......::....:|||.|..:||| .||.:::::||.|||..  |.|.:.:.:.|.
Mouse   196 CDYDYLRFLVHRFRYHLGNDVILFTTDGASEKMLKCGTLQDLYATVDFGTG--NNITQAFLVQRK 258

  Fly   273 LQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANY 337
            .:|.|||:|||||.|||.||.:.:.....:.:|.:|..:|:..|:||||||.|||||.:..||| 
Mouse   259 FEPKGPLINSEFYTGWLDHWGKPHSTVKTKTLATSLYNLLARGANVNLYMFIGGTNFAYWNGAN- 322

  Fly   338 NLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVIGEFLPLPEITLNPA-KRLAYGRVELTP 401
                 ..|....|||||||.:.|||.:|.||..::.||..|..:||..:.|: .:.|||:|.|..
Mouse   323 -----TPYEPQPTSYDYDAPLSEAGDLTKKYFALREVIQMFKEVPEGPIPPSTPKFAYGKVALRK 382

  Fly   402 KLTLLSTEGRAALSKGDPVESIKPKTFEELDLYSGLVLYETELPSMDLDPALL---KIDQINDRA 463
            ..|:  .|....|....||:|:.|.||.::..|.|.|||.|.||....:|..:   ..:.:.|||
Mouse   383 FKTV--AEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYRTTLPQDCSNPKPIFSSPFNGVRDRA 445

  Fly   464 HVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNG 526
            :|.||....|.|.|.. :.:|.:....|:||.:||||.||||:  :| ||.||:...:::     
Mouse   446 YVSVDGVPQGILDRNL-MTALNIRGKAGATLDILVENMGRVNYGRFI-NDFKGLISNMTI----- 503

  Fly   527 GYLPLENWRSTAFPLEQSAV---ELWRREHTDEKALDPLLARQRILRNG-----PILYTGSLTVT 583
            ....|.||  |.|||...|:   .||.||.:||..||     .|...|.     |..|.|:.::.
Mouse   504 NSTVLTNW--TVFPLNTEAMVRNHLWGREASDEGHLD-----GRSTSNSSDLILPTFYVGNFSIP 561

  Fly   584 E-----VGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKV-GENSLVILEYQRA 642
            .     ..||::...||.||..::||||||||||..|||.||:||..||.. ..|::.:||.:.|
Mouse   562 SGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQKTLFVPRNILTTSAPNNITVLELEFA 626

  Fly   643 NKTATGEDLPAVQF 656
            ..:....:|..|:|
Mouse   627 PCSEGTPELCTVEF 640

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 154/324 (48%)
BetaGal_dom4_5 <570..637 CDD:290101 30/78 (38%)
Glb1NP_033882.1 Glyco_hydro_35 41..355 CDD:279624 153/323 (47%)
BetaGal_dom4_5 <553..621 CDD:290101 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13204497
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 508 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T131024
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.