DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and GLB1L3

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_011540868.1 Gene:GLB1L3 HGNCID:25147 Length:700 Species:Homo sapiens

Alignment Length:662 Identity:229/663 (35%)
Similarity:323/663 (49%) Gaps:109/663 (16%)


  Fly    39 APEEQPRFTIDH---------------EAN-----TFMLDGQPFRYVSGSFHYFRAVPESWRSRL 83
            |...||||...|               |:.     .|.|:|..|....||.||||...|.||.||
Human    91 AHPSQPRFNWSHLTPLELKNRSVGLGTESTGRGKPHFTLEGHKFLIFGGSIHYFRVPREYWRDRL 155

  Fly    84 RTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGG 148
            ..::|.|.|.:.|||.|:||.|..|::::.|..|:..|:.:|.|...::|||||.|||:|.|.||
Human   156 LKLKACGFNTVTTYVPWNLHEPERGKFDFSGNLDLEAFVLMAAEIGLWVILRPGRYICSEMDLGG 220

  Fly   149 LPHWLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDYACDHDY 213
            ||.||. :.|.:.:||.:.::|..|.|::..|:||:..|.....|.:|.||||||||.:..|..|
Human   221 LPSWLL-QDPRLLLRTTNKSFIEAVEKYFDHLIPRVIPLQYRQAGPVIAVQVENEYGSFNKDKTY 284

  Fly   214 LNWLRDETEKYVSGKA--------LLFTVDIPNEKMSCGKIENVFATTD---FGIDRINEIDKIW 267
            :.:|.         ||        ||.|.|.....:| |..:.|.|..:   ...|..|::.|: 
Human   285 MPYLH---------KALLRRGIVELLLTSDGEKHVLS-GHTKGVLAAINLQKLHQDTFNQLHKV- 338

  Fly   268 AMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYMFFGGTNFGFT 332
                  |...||:..|::.||...|.:::..:|.:||.:|:...:.|..|.|:|||.|||||||.
Human   339 ------QRDKPLLIMEYWVGWFDRWGDKHHVKDAKEVEHAVSEFIKYEISFNVYMFHGGTNFGFM 397

  Fly   333 AGANY-NLDGGIGYAADITSYDYDAVMDEAGGVTTKY----NLVKAVIGEFLPLPEITLNPAKRL 392
            .||.| ....||     :||||||||:.|||..|.||    .|.::|  ...|||.:...|.|.:
Human   398 NGATYFGKHSGI-----VTSYDYDAVLTEAGDYTEKYLKLQKLFQSV--SATPLPRVPKLPPKAV 455

  Fly   393 AYGRVELTPKLTLLSTEGRAALSKGDPVESIKPKTFEELDLYS------GLVLYETELPSMDLDP 451
             |..|.  |.|.|...:..:.|:  :||.|.:|...|.|.:.:      ||||||..:.|.....
Human   456 -YPPVR--PSLYLPLWDALSYLN--EPVRSRQPVNMENLPINNGSGQSYGLVLYEKSICSGGRLR 515

  Fly   452 ALLKIDQINDRAHVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKG 514
            |     ..:|.|.||:|:.::|.|:...:...:|..:.. ..|::||||||||||  .|.|:.||
Human   516 A-----HAHDVAQVFLDETMIGILNENNKDLHIPELRDC-RYLRILVENQGRVNFSWQIQNEQKG 574

  Fly   515 IFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWR-REHTDEKALDPLLARQRILRNGPILYTG 578
            |.|.||  ::|..   ||.:  |.:.||.......| |..|.:...|.        ..||..|.|
Human   575 ITGSVS--INNSS---LEGF--TIYSLEMKMSFFERLRSATWKPVPDS--------HQGPAFYCG 624

  Fly   579 SLTVTEVG----DTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEY 639
            :|   :.|    ||:|::..|..|..::||.||||||.: |||.|||:|...|...:|.:::.| 
Human   625 TL---KAGPSPKDTFLSLLNWNYGFVFINGRNLGRYWNI-GPQKTLYLPGVWLHPEDNEVILFE- 684

  Fly   640 QRANKTATGEDL 651
                |..:|.|:
Human   685 ----KMMSGSDI 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 128/338 (38%)
BetaGal_dom4_5 <570..637 CDD:290101 28/71 (39%)
GLB1L3XP_011540868.1 Glyco_hydro_35 127..435 CDD:279624 126/331 (38%)
BetaGal_dom4_5 606..678 CDD:290101 29/84 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13197410
eggNOG 1 0.900 E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128163
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.