DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and Tmppe

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001186931.1 Gene:Tmppe MGIID:5317335 Length:447 Species:Mus musculus

Alignment Length:168 Identity:32/169 (19%)
Similarity:59/169 (35%) Gaps:44/169 (26%)


  Fly    43 QPRFTI------DHEANTFMLDGQPF---------RYVSGSFHYFRAVPESWRSRLRTMRASGLN 92
            :|..|:      |.||:.......|.         .:|:|:..|:.:...:|.:.|.::....|:
Mouse   237 EPDITVIVGDLSDSEASVLRTAVAPLGQLHSRLGTYFVTGNHEYYTSDVSNWFTLLESLHVRPLH 301

  Fly    93 ALDTYV-------------EW-SLHNPHDGE-----YNWEGIADVVKFLEIAQEEDFYIILRPGP 138
            ..:..:             || .|....|.|     |:..|: |:.|.||....:|..|:|...|
Mouse   302 NENVKISAPGDPDSAGRDREWVCLAGVDDIEADILHYSGHGM-DLDKALEGCSPDDATILLAHQP 365

  Fly   139 YICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGKW 176
             :.|:|        .....|.|.:..:...:..::..|
Mouse   366 -LAAKR--------ALQARPDINLILSGHTHAGQIFPW 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 27/152 (18%)
BetaGal_dom4_5 <570..637 CDD:290101
TmppeNP_001186931.1 MPP_YkuE_C 206..443 CDD:277331 32/169 (19%)
Metallophos 207..387 CDD:278574 31/160 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.