DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and glb1l2

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_017951376.1 Gene:glb1l2 XenbaseID:XB-GENE-5887285 Length:617 Species:Xenopus tropicalis

Alignment Length:654 Identity:225/655 (34%)
Similarity:341/655 (52%) Gaps:76/655 (12%)


  Fly    29 LCVGLSGDTDAPEEQPRFT-------IDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTM 86
            :.:.||.....|.:|..||       :....:.|:|:..|:|.:.||.||||.....||.|::.|
 Frog     1 MSIFLSCRLSLPSQQISFTNMPRTSGLKIGNSHFLLNDIPYRILGGSMHYFRVPTAYWRDRMKKM 65

  Fly    87 RASGLNALDTYVEWSLHNPHDGEYNWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPH 151
            :|.|:|.|.|||.|:||.|..|.|::....|:.:||.:|.|...::|||||||||||.|.||||.
 Frog    66 KACGINTLTTYVPWNLHEPGKGTYDFNNGLDISEFLAVAGEMGLWVILRPGPYICAEWDLGGLPS 130

  Fly   152 WLFTKYPSIKMRTNDPNYISEVGKWYAELMPRLQHLFVGNGGKIIMVQVENEYGDYACDHDYLNW 216
            ||. :...:|:||..|.:...|..::.||:||:......|||.||.||||||||.||.|.:|:.:
 Frog   131 WLL-RDKDMKLRTTYPGFTEAVDDYFNELIPRVAKYQYSNGGPIIAVQVENEYGSYAKDANYMEF 194

  Fly   217 LRDE-TEKYVSGKALLFTVDIPNEKMSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLV 280
            :::. .|:.:  ..||.|.| ..:.:|.|.:|.|.||.:|  .:|..:  :::.|.::||..|::
 Frog   195 IKNALIERGI--VELLLTSD-NKDGISYGSLEGVLATVNF--QKIEPV--LFSYLNSIQPKKPIM 252

  Fly   281 NSEFYPGWLTHWQEQNQRRDGQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGY 345
            ..||:.||..:|...:...|.:.:.:.:..:|:..|::|||||.|||||||.:||.:..:    |
 Frog   253 VMEFWTGWFDYWGGDHHLFDVESMMSTISEVLNRGANINLYMFHGGTNFGFMSGALHFHE----Y 313

  Fly   346 AADITSYDYDAVMDEAGGVTTKYNLVKAVIGEF------LPLPEITLNPAKRLAYGRVELTPKLT 404
            ..|||||||||.:.|||..|:|:..::.:.|::      .|:|.::|    :.:||.|||...|.
 Frog   314 RPDITSYDYDAPLTEAGDYTSKFFKIRELFGDYNAEKPLPPVPSLSL----KASYGPVELKRCLP 374

  Fly   405 LLS----TEGRAALSKGDPVESIKPKTFEELDLYS------GLVLYETELPSMDLDPALLKIDQI 459
            |..    .|        :|.:|.:|...|.|.:..      |..||||.:..   .........|
 Frog   375 LWEVLPFVE--------EPFKSAEPVNMENLPVNDGNGQSYGYTLYETIIYG---GGKFHTKGNI 428

  Fly   460 NDRAHVFVDQELVGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQ 522
            :|||.:|...:.:||:..:.:...:|....: ..|.:||||.||||:  .|.|..|||.|:|.|:
 Frog   429 HDRAQIFASSQSIGTVDYKKEELDIPEVPAY-RKLSILVENCGRVNYGPMIDNQRKGIVGDVYLR 492

  Fly   523 LHNGGYLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQRILRNGPILYTGSLTVTEVG- 586
            .:     ||:|::..:..:..:.:......|..:.:         ..::||..|.|:|   .|| 
 Frog   493 DN-----PLKNFKIYSLDMNSTFMNRINEVHWSDLS---------ECKSGPTFYQGAL---HVGP 540

  Fly   587 ---DTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTLYVPNEILKVGENSLVILEYQRANKTATG 648
               ||:|.:.||.|||.::||.||||||.: |||.||::|...|..|.|.:.|.|...|..|...
 Frog   541 TPMDTFLRLQGWKKGVVFINGKNLGRYWDI-GPQETLFIPAPWLWPGVNEITIFEEYAAGLTLFT 604

  Fly   649 EDLP 652
            .|.|
 Frog   605 LDTP 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 130/323 (40%)
BetaGal_dom4_5 <570..637 CDD:290101 33/71 (46%)
glb1l2XP_017951376.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.