DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gal and glb1l

Sequence 1:NP_608978.2 Gene:Gal FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001116328.1 Gene:glb1l ZFINID:ZDB-GENE-050309-196 Length:629 Species:Danio rerio

Alignment Length:612 Identity:250/613 (41%)
Similarity:344/613 (56%) Gaps:45/613 (7%)


  Fly    46 FTIDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEY 110
            |:||::.|.|..||:||:|:|||.||.|...|.|:.||..|..:||||:..||.|:.|....|.|
Zfish    27 FSIDYKNNCFRKDGKPFQYISGSIHYSRIPREYWQDRLLKMYMTGLNAIQVYVPWNFHETVQGVY 91

  Fly   111 NWEGIADVVKFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEVGK 175
            |:.|..|:..||.:|.:....:|||||||||||.:.||||.||..| |:|.:|:.|..|:.....
Zfish    92 NFAGDRDLEYFLNLANQTGLLVILRPGPYICAEWEMGGLPAWLLQK-PNIILRSADKEYLQAASD 155

  Fly   176 WYAELMPRLQHLFVGNGGKIIMVQVENEYGDY-ACDHDYLNWLRDETEKYVSGKALLFTVDIPNE 239
            |.|.|:.:::.....|||.||.||||||||.| |||::|:..|......::....:|||.|...:
Zfish   156 WLAVLLAKMRPWLYQNGGNIISVQVENEYGSYFACDYNYMRHLHTLFRLFLGEDVILFTTDGNTD 220

  Fly   240 K-MSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRDGQE 303
            | ||||.:|.::||.|||.|  ..|...:...|..:|.|||||||||.|||.||.:::...|..:
Zfish   221 KEMSCGTLEGLYATIDFGTD--TNITTAFIRQRRFEPKGPLVNSEFYTGWLDHWGDKHASVDTNK 283

  Fly   304 VANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKY 368
            |:..|..:||..||||:|||.||||||:..||:::    ..:.:.:|||||:|.:.|||..|.|.
Zfish   284 VSKMLGEMLSMGASVNMYMFEGGTNFGYWNGADHD----TRFRSVVTSYDYNAPLTEAGDPTDKL 344

  Fly   369 NLVKAVIGEFLPLPEITLNPA-KRLAYGRVEL------TPKLTLLSTEGRAALSKGDPVESIKPK 426
            ..::.||..|..:|...:.|| .:||||.|.|      :..|..||.:|        ||.|..|.
Zfish   345 LAIRDVIKNFRDIPVGPMPPATPKLAYGFVTLHKVGNISSLLDTLSPQG--------PVRSQYPL 401

  Fly   427 TFEELDLYSGLVLYETELPS--MDLDPALLKIDQINDRAHVFVDQELVGTLSREAQIYSLPLSKG 489
            ||||:..|.|.:||.|.||.  .:..|.:..::.|:|||:|.|:....|.:.|:..:. :.::..
Zfish   402 TFEEIKQYYGFLLYRTTLPRNVPEPTPLISPLNGIHDRAYVSVNGVYQGLMERDTGLV-MNITGR 465

  Fly   490 WGSTLQLLVENQGRVNF--YISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFPLEQSAVELWRRE 552
            .|..|.:||||.|||||  || ||.||:.|.:.|     |...|.:|......::.:....|.  
Zfish   466 QGDQLDILVENMGRVNFGSYI-NDNKGLLGNLIL-----GNDVLSDWSVYPLDIDTAVANGWL-- 522

  Fly   553 HTDEKALDPLLARQRILRNGPILYTGSLTVT-EVGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGP 616
               :.|...||..   ..:|||.|:|:|..| ...||::.:.||.||..:|||||||||||..||
Zfish   523 ---QSAHSGLLTE---AGDGPIFYSGTLKPTGRAWDTFVKLNGWTKGQVWVNGFNLGRYWPKRGP 581

  Fly   617 QVTLYVPNEILKVGE-NSLVILEYQRA 642
            |.|||||...|...: |::.:||.:||
Zfish   582 QQTLYVPGPFLSANQLNNITVLELERA 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 144/324 (44%)
BetaGal_dom4_5 <570..637 CDD:290101 34/69 (49%)
glb1lNP_001116328.1 Glyco_hydro_35 36..352 CDD:279624 144/323 (45%)
BetaGal_dom4_5 <536..603 CDD:290101 34/67 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13172825
eggNOG 1 0.900 E1_COG1874
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 482 1.000 Inparanoid score I1383
OMA 1 1.010
OrthoDB 1 1.010 D179316at2759
OrthoFinder 1 1.000 FOG0001881
OrthoInspector 1 1.000 T128785
orthoMCL 1 0.900 OOG5_128163
Panther 1 1.100 O PTHR23421
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.