DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14000 and CG30184

DIOPT Version :9

Sequence 1:NP_608969.1 Gene:CG14000 / 33820 FlyBaseID:FBgn0031749 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster


Alignment Length:255 Identity:58/255 - (22%)
Similarity:87/255 - (34%) Gaps:56/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VWVFFKLIEVLLGSVCMFFHIRGSSYWPERTPHVILYCATFSSFTALAALGAFRLLLARSTVLSS 68
            ||..||::|:||...|...|  .:.:..|..||:.|.|.|:.....:..:.......|....:..
  Fly     9 VWFLFKMMELLLSLGCCLVH--WTCFMEEGVPHIFLLCGTYGGSVIICFISLIGAFYAERPTMKH 71

  Fly    69 QLLLTLSAVLSHYFCGVLIMRTAMLDPHLAFINSTIEYLEH------PHF-AHCKQQSIAALVTG 126
            :.|          |.|:|    ..|.....:.|..:..||.      |.| |.|:..:|.||..|
  Fly    72 EAL----------FGGIL----GGLHMVTVYANMYVATLEEFRTERWPSFYACCRDNAIVALYAG 122

  Fly   127 TMYLMHMFHVFDLLMRMEPGDWKRQATGRKYFEGTESGSTGLFVLSKPVDDFLCKCCRCYYKLAN 191
            .:||||.....||:.     ...|....:|...........|:.:|:..:.:|            
  Fly   123 AIYLMHCTFALDLMF-----SHSRSRANQKMHPQRSKRPLQLYFISRGAEAYL------------ 170

  Fly   192 SQILYFRPNA----EVEQP--HFIVRMWQFIGDARKKFFSLHQIESDESFLSTPTITTSE 245
            |:..:||..|    ...||  |          ..||:..|..:.:||........|..||
  Fly   171 SRFWFFRRIAARMLTSAQPSEH----------SGRKRQVSSSESDSDAKEREEERIRNSE 220



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR41152
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.