DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TrissinR and AstC-R1

Sequence 1:NP_001097092.1 Gene:TrissinR FlyBaseID:FBgn0085410 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster

Alignment Length:548 Identity:120/549 (22%)
Similarity:187/549 (34%) Gaps:190/549 (35%)


  Fly   100 WKTLLILLTLLSASTLTASANVTSTISPPINGSSTDYILLYGESTTSLVPALTTGLSGDGSGAVI 164
            |..:.:|..:....|..:.||.|       |..:|:..|.    ||.|.....:|.|      .|
  Fly     4 WLMMDVLQFVKGEMTADSEANAT-------NWYNTNESLY----TTELNHRWISGSS------TI 51

  Fly   165 EDEE-----DAEKASEYIFDRTDVRIIF-ITLYTLVFCCCFFGNLLVILVVTLSRRLRSITNFFL 223
            :.||     |.......|..|.....:| :.||..|.....|||.|||.||....:::::||.::
  Fly    52 QPEESLYGTDLPTYQHCIATRNSFADLFTVVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYI 116

  Fly   224 ANLAFADFC--VGLFCVMQNLSIYLIESWVFGEFLCRMYQFVHSL-SYTASIFILVVICMERYFA 285
            .|||.||.|  :|:..::..:.|.   ||.||||:|:.|....|: |:|:|||:| ::..:||.|
  Fly   117 LNLAVADECFLIGIPFLLYTMRIC---SWRFGEFMCKAYMVSTSITSFTSSIFLL-IMSADRYIA 177

  Fly   286 IVHPITCKQILTAARLRMVIVTVWITSAVYSTPKFVFSKTIKNIHTQDGQEEEICVLDREMF--- 347
            :.|||:..:..|....::|....|.||||...|..:::.|::.   :||......::..:.:   
  Fly   178 VCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQ---EDGINYSCNIMWPDAYKKH 239

  Fly   348 NSKLLDMINFVLLYVMPLLVMTVLYSKIAIALWRSSRGLTPHVVQHQHQQPQQPSCQDIGMGMHN 412
            :.....:..|.|.:..||..:...|..:.                                    
  Fly   240 SGTTFILYTFFLGFATPLCFILSFYYLVI------------------------------------ 268

  Fly   413 SMYHHHPHHHHHHHQHHQLQSAASSAGVVGVGLGGGGGGGPGPSLASGGSSTTSLSRKQSSKYEK 477
                            .:|:|.                 ||.|...|               .||
  Fly   269 ----------------RKLRSV-----------------GPKPGTKS---------------KEK 285

  Fly   478 RGVSITESQLDNCKVSLEADRPIVSACRKTSFYHHGHAHHQRAGNASVGGGSGGAGAGATHMSHS 542
            |                                                                
  Fly   286 R---------------------------------------------------------------- 286

  Fly   543 SSNVLRARRGVVRMLIIFVLTFALCNLPYHARKMWQYWSRSYRGD-SNFNALLTPLTFLVTYFNS 606
                 ||.|.|.|:::..:..:.||.||:...::....|...:.| |....|:..|...:.|.||
  Fly   287 -----RAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLLGALVYSNS 346

  Fly   607 GVNPLLYAFLSRNFRKGMKELLLCSWKK 634
            .|||:||||||.||||...:...|..|:
  Fly   347 AVNPILYAFLSENFRKSFFKAFTCMNKQ 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TrissinRNP_001097092.1 7tm_4 191..>327 CDD:304433 50/139 (36%)
7tm_1 201..>385 CDD:278431 54/190 (28%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 94/440 (21%)
7tm_1 94..353 CDD:278431 84/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3389
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.