DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7239 and CG14252

Sequence 1:NP_608960.2 Gene:CG7239 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651513.1 Gene:CG14252 FlyBaseID:FBgn0039462 Length:405 Species:Drosophila melanogaster

Alignment Length:499 Identity:80/500 (16%)
Similarity:154/500 (31%) Gaps:190/500 (38%)


  Fly    38 ARRYWTPSEEERLYEIWGRDNWRLTRTGKN-TIFFGRWAEELRDRFAVDVKPEEIQMKVNQTRAK 101
            :||.|..|||:|..:|| ..|..|...||. |..:.......|| ..|::..:.|:.|:...:.|
  Fly     2 SRRKWDASEEDRFIDIW-IHNLHLFEPGKKLTETYAELEPYFRD-VGVEINVQGIKSKMESLKRK 64

  Fly   102 FRQVKKQLQADPSSYATRWKKYDIINRILKNLHRPKNADPLPPEALLNNRDMTPPRDDASAEQLQ 166
            :..:   |.:|....|..|:.:|.:..:::                            |||.:  
  Fly    65 YFNL---LHSDQEDQAITWRHFDAMALVVR----------------------------ASANE-- 96

  Fly   167 QQPQQQSVQQQQQQGLGLASEPSTATYYNSSSNSNHGSSHNNNTSGGVSFNTELFTDQYDEVVKQ 231
                            |..||....|..:.:.:....|.:.||.:..:.:.|...|...||....
  Fly    97 ----------------GKDSEWKDYTQPSKTPHKTRSSVYMNNPAQRIKYETPFKTVFVDESAVN 145

  Fly   232 EYEDDEYRSIPFQEQLQQ---------------YSPAEPAQLLE--------LQTPQQQQQLQQQ 273
            .::|:|   :|..:::::               :.|||....::        :|:.:::..:.:.
  Fly   146 YFDDEE---MPNAKRVRKRFGKTSNVRVKARRVWQPAEECIFVDVWEKFASHIQSDRKKMDVYKD 207

  Fly   274 QQQQQQ----------FQTNYESQFQ------------------------QQPAQFNNNSVISTA 304
            ...:.|          .::..||..:                        |.|..|....|.|..
  Fly   208 MHNELQLRGVGILPGDIKSKIESLMRTFRAQRDSVGDKSEWIHYSKILKIQTPIDFTKLDVFSEH 272

  Fly   305 ATS------------------TVNHQPITAVAYINSSNNTISVATNANGGMPAPVPAQVSASVPA 351
            ::|                  .::|.|.::.:.:|..:|                  :...|.||
  Fly   273 SSSYEDDASWFKELEPKPDPDPISHPPSSSDSVVNQFDN------------------KTQPSSPA 319

  Fly   352 AAPVSTTNNAVVGASPVPVPRKRGRPFGSVNPPHAD-SLEALYMEEVRRKNQLLYEQTKICRQRL 415
            .:....                    :....|.|.. |:|.|..:|..:.    :|...|.:.:.
  Fly   320 CSEDCF--------------------WSDTEPSHCKVSIEVLDQDESTKP----FESPSIEKHKA 360

  Fly   416 ----------ELEERKVDLMQTFFPKCLEQQAQILSHVLQLQKQ 449
                      ||.....||:       :|.:.||.:.:..|||:
  Fly   361 AEEFSQFVTKELAVLNDDLL-------IEAKRQIYNIICVLQKK 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 24/86 (28%)
CG14252NP_651513.1 Myb_DNA-bind_4 3..85 CDD:290549 25/87 (29%)
Myb_DNA-bind_4 173..253 CDD:290549 7/80 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22666
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.