DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7239 and CG11560

Sequence 1:NP_608960.2 Gene:CG7239 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001303392.1 Gene:CG11560 FlyBaseID:FBgn0036249 Length:307 Species:Drosophila melanogaster

Alignment Length:279 Identity:50/280 (18%)
Similarity:89/280 (32%) Gaps:89/280 (32%)


  Fly    79 RDRFAVDVKPEE--------IQMKVNQTRAKFRQVKKQLQ----------ADPSSYATRWKKYDI 125
            |:.|.:....||        |.||:|.  .::|.|||..:          |.|.....:|:.:.:
  Fly     8 RNMFFIHAPEEEKCMEAQLDILMKINS--GEYRLVKKNKRSSVWNVYREIARPDGTKLKWRYFCM 70

  Fly   126 ----------------------INRILKNLHRPKNA-----DPLPPEALLNNRDMTPPRDDASAE 163
                                  :..|.:|.|....:     ||.||.:..:.|...|.       
  Fly    71 GCKRVMQSTGGTTSNLRIHKCHVRYIKQNGHLTDGSHSYDHDPAPPASQPSPRVQKPK------- 128

  Fly   164 QLQQQPQQQSVQQQQQQGLGLASEPSTATYYNSSSNSNHGSSHNNNTSGGVSFNTELFTDQYDEV 228
              .::|...|.|.:|...:.:..|    |.|:...:....|.....|                 :
  Fly   129 --TRRPTSYSTQCEQFYEVTMDPE----TQYSDLDDEIEASLEEEQT-----------------I 170

  Fly   229 V-----KQEYEDDEYRSI--PFQEQLQQYSPAEPAQLLELQTPQQQQQLQQQQQQQQQFQTN--- 283
            :     |:|.|....|.:  .|.|:.....|.||...:|:...:.|..::......|...::   
  Fly   171 ILQLKSKRELESSHSRPLLKLFSEENLSTEPEEPEDEIEIVEAEDQVPIELDLCDIQHTTSDAGG 235

  Fly   284 --YESQFQQQPAQFNNNSV 300
              .|.:..:..|||:.|::
  Fly   236 EAIEPKPTESVAQFDANAI 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 15/63 (24%)
CG11560NP_001303392.1 ZnF_BED 48..93 CDD:214746 3/45 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22666
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.