DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7239 and MSANTD1

DIOPT Version :9

Sequence 1:NP_608960.2 Gene:CG7239 / 33809 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001036155.1 Gene:MSANTD1 / 345222 HGNCID:33741 Length:278 Species:Homo sapiens


Alignment Length:275 Identity:57/275 - (20%)
Similarity:99/275 - (36%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GGSGSGAEQDLGMCGGQELLDGRGKEKARRYWTPSEEERLYEIWGRDNWRLTRTGKNTIFFGRWA 75
            |.||..|.:..|.....:    ..|.:..|.||.:|...|..:|......|.:|.:|...:.:.|
Human    19 GASGMAAAEGPGYLVSPQ----AEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMA 79

  Fly    76 EELRDRFAVDVKPEEIQMKVNQTRAKFRQVKKQLQADPSSYATRWKKYDIINRILKNLHRPKNAD 140
            .:|.:........|||::|:.....::|::|  ...|..|....|..|..|:.||..:  |::.|
Human    80 SKLFEMTGERRLGEEIKIKITNMTFQYRKLK--CMTDSESAPPDWPYYLAIDGILAKV--PESCD 140

  Fly   141 PLPPEALLNNRDMTPPRDDASAEQLQQQPQQQSVQQQQQQGLGLASEPSTATYYNSSSNSNHGSS 205
            ...|       |..||....|..:....|..:                ||..|:..:..|..|..
Human   141 GKLP-------DSQPPGPSTSQTEASLSPPAK----------------STPLYFPYNQCSYEGRF 182

  Fly   206 HNNNTSGGVSFNTELFTDQYDEVVKQEYEDDEYRSIPFQ------EQLQQYSPAEPAQLLELQTP 264
            .::.:....|..:..|..:...|.|::.:....:....:      |:.::.|.|......|::..
Human   183 EDDRSDSSSSLLSLKFRSEERPVKKRKVQSCHLQKKQLRLLEAMVEEQRRLSRAVEETCREVRRV 247

  Fly   265 QQQQQLQQQQQQQQQ 279
            ..||.:.|.|..|.|
Human   248 LDQQHILQVQSLQLQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 20/84 (24%)
MSANTD1NP_001036155.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 4/7 (57%)
Myb_DNA-bind_4 44..125 CDD:316362 20/82 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..168 8/52 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.