DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7239 and CG14005

Sequence 1:NP_608960.2 Gene:CG7239 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_608959.1 Gene:CG14005 FlyBaseID:FBgn0031739 Length:317 Species:Drosophila melanogaster

Alignment Length:431 Identity:79/432 (18%)
Similarity:139/432 (32%) Gaps:142/432 (33%)


  Fly    34 GKEKAR-RYWTPSEEERLYEIWGRDNWRLTRTGKNTIFFGRWAEELRDRFAVDVKPEEIQMKVNQ 97
            |::..| ||:|..||..|..:|......:.....|...|...|..|:.. .|.:..:|.:.::|.
  Fly     3 GQKHLRLRYYTSLEEAMLLRLWREHLHAIPSYTDNLPIFREIAHGLQQN-GVRLNKQEARRRINS 66

  Fly    98 TRAKFRQVKKQLQADPSSYATRWKKYDIIN----------------RILKNLHRPKNAD--PLPP 144
            .|.|:...:.::..: :::|..|:.|.:|:                .:|:.:......|  .|||
  Fly    67 YRNKYLNDRNRVGGN-ANFAKDWRLYALIDCLFCPAWPSSALFHFRNVLETIRATARVDLPALPP 130

  Fly   145 EALLNNRDMTPPRDDASAEQLQQQPQQQSVQQQQQQGLGLASEPSTATYYNSSSNSNHGSSHNNN 209
            ....:...:...||......|..||...:|                                   
  Fly   131 LLYTSPAQLKFERDSEGCTFLDAQPLVPAV----------------------------------- 160

  Fly   210 TSGGVSFNTELFTDQYDEVVKQEYEDDEYRSIPFQEQLQQYSPAEPAQLLELQTPQQQQQLQQQQ 274
                  ..||...|::.::|..||:       |...||:                          
  Fly   161 ------VKTEPLPDEHHQLVNIEYK-------PTVTQLE-------------------------- 186

  Fly   275 QQQQQFQTNYESQFQQQPAQFNNNSVISTAATSTVNHQPITAVAYINSSNNTISVATNANGGMPA 339
                    |..|.:.::           ..|.|.:...|:|...:|...........:.|||.  
  Fly   187 --------NAASHYLER-----------ATAESVIQRSPLTPANHILPEAEDAPYGGHTNGGQ-- 230

  Fly   340 PVPAQVSASVPAAAPVSTTNNAVVGASPVPVPRKRGRPFGSVNPPHADSLEALYMEEVRRKNQLL 404
             ..|:.|||                      .|:|||  .|: .||:..:....:|.:|::|.||
  Fly   231 -TDAERSAS----------------------KRRRGR--RSI-LPHSGKITMAIVEALRKENSLL 269

  Fly   405 YEQTKICRQRLELEERKVDLMQTFFPKCLEQQAQILSHVLQ 445
            .:|...|.|.|..:|::...|:..|...:|:|..:|:.:.|
  Fly   270 EQQNDACLQSLVRKEKQFLDMKHNFLAYMERQEAVLALIKQ 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 20/86 (23%)
CG14005NP_608959.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22666
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.