DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and ftsE

DIOPT Version :10

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_417920.1 Gene:ftsE / 947968 ECOCYCID:EG10340 Length:222 Species:Escherichia coli


Alignment Length:196 Identity:60/196 - (30%)
Similarity:93/196 - (47%) Gaps:17/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG-----AKP 71
            |.|.:.    .|..:..::..|.:..|.|.||.||:|||..|.|..|.:.|::...|     .|.
E. coli    11 YLGGRQ----ALQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIWFSGHDITRLKN 71

  Fly    72 GEPGSGVPGSR--VGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFK-LLKELLQLPPAR 133
            .|    ||..|  :|.:.|:..|:.:.||.:.:.....|.|.:.:.||.:.. .|.::..|..|:
E. coli    72 RE----VPFLRRQIGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSAALDKVGLLDKAK 132

  Fly   134 QMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHY 198
            ....|.|||:|:|:..|.|:::.|.:|:.||||..||..|.|.|.....|..|.. :.|::.||.
E. coli   133 NFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRVG-VTVLMATHD 196

  Fly   199 I 199
            |
E. coli   197 I 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 4..245 CDD:440746 60/196 (31%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
ftsENP_417920.1 PRK10908 1..222 CDD:182829 60/196 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.