DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and fetA

DIOPT Version :10

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_415023.1 Gene:fetA / 946990 ECOCYCID:G6266 Length:225 Species:Escherichia coli


Alignment Length:205 Identity:51/205 - (24%)
Similarity:85/205 - (41%) Gaps:41/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIV-------GQRRLNGGEVVVLGAKPGEPGSGVP 79
            :||.:|.::..|....:.|.|||||:|||..:.       |.....|.:|..|  ||     .:.
E. coli    22 ILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTL--KP-----EIY 79

  Fly    80 GSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIR-------------EKFKLLKELLQLPP 131
            ..:|.:..|...|..:......||.:         :||             |:|.|...:|    
E. coli    80 RQQVSYCAQTPTLFGDTVYDNLIFPW---------QIRNRQPDPAIFLDFLERFALPDSIL---- 131

  Fly   132 ARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITT 196
             .:.|.:.|||:::|:|....:...|::|:|||.|..||...:..:.:.:....|...:||:..|
E. coli   132 -TKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVT 195

  Fly   197 HYIEEAKQAN 206
            |..:|...|:
E. coli   196 HDKDEINHAD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 4..245 CDD:440746 51/205 (25%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
fetANP_415023.1 PRK10247 1..225 CDD:182331 51/205 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.