DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and artP

DIOPT Version :10

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_415385.1 Gene:artP / 945489 ECOCYCID:EG11624 Length:242 Species:Escherichia coli


Alignment Length:222 Identity:62/222 - (27%)
Similarity:108/222 - (48%) Gaps:15/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NGYK-YYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG--- 68
            ||.. :||:..    .|..:.::..:|....|||.||.||::||..:........|.:.:.|   
E. coli     6 NGINCFYGAHQ----ALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHF 66

  Fly    69 ---AKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFG-RIYGLT-DERIREKFKLLKELLQ 128
               ..|.:.........||.:.|:..|...:||::.:.... |:.||: |:.:....|||:.|..
E. coli    67 DFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRL 131

  Fly   129 LPPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVI 193
            .|.:.:.....|||||:|::.|.|::.:|::|:.||||..|||.:..:|...:.|.. .:.:..:
E. coli   132 KPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELA-ETNITQV 195

  Fly   194 ITTHYIEEA-KQANCIGLMRNGVLLAE 219
            |.||.:|.| |.|:.:..|.||.::.:
E. coli   196 IVTHEVEVARKTASRVVYMENGHIVEQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 4..245 CDD:440746 62/222 (28%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
artPNP_415385.1 artP 1..242 CDD:182980 62/222 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.