DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and ABCB19

DIOPT Version :10

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_189528.1 Gene:ABCB19 / 822519 AraportID:AT3G28860 Length:1252 Species:Arabidopsis thaliana


Alignment Length:262 Identity:61/262 - (23%)
Similarity:120/262 - (45%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SNPKI-VLNQLNMNVMRGSIYGLLGASGCGKTTLLSCI-------VGQRRLNGGEVVVLGAKPGE 73
            |.|.: |....|:.:..|....|:||||.||:::::.|       .|:..::|.::..|..|...
plant  1021 SRPDVMVFRDFNLRIRAGHSQALVGASGSGKSSVIAMIERFYDPLAGKVMIDGKDIRRLNLKSLR 1085

  Fly    74 PGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKL---------LKELLQL 129
                   .::|.:.||.||. ..|:.:.|.| |: .|.|:..:.:..:.         |.|..:.
plant  1086 -------LKIGLVQQEPALF-AATIFDNIAY-GK-DGATESEVIDAARAANAHGFISGLPEGYKT 1140

  Fly   130 PPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDP----MLREKIWDFLVETTRNSKL 190
            |...:.: |.||||::|::.|.|::.:|.:|:|||.|..||.    :|:|.:     |.....:.
plant  1141 PVGERGV-QLSGGQKQRIAIARAVLKNPTVLLLDEATSALDAESECVLQEAL-----ERLMRGRT 1199

  Fly   191 AVIITTHYIEEAKQANCIGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNEDELAQIM 255
            .|:: .|.:...:..:|||::::|.::.:.:.:.               ::|:.:|....|.|:.
plant  1200 TVVV-AHRLSTIRGVDCIGVIQDGRIVEQGSHSE---------------LVSRPEGAYSRLLQLQ 1248

  Fly   256 DH 257
            .|
plant  1249 TH 1250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 4..245 CDD:440746 57/248 (23%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
ABCB19NP_189528.1 MdlB 26..604 CDD:440747
MdlB 666..1248 CDD:440747 60/258 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.