DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and Abca1

DIOPT Version :10

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_006537617.1 Gene:Abca1 / 11303 MGIID:99607 Length:2263 Species:Mus musculus


Alignment Length:231 Identity:70/231 - (30%)
Similarity:124/231 - (53%) Gaps:8/231 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG 68
            |.::|..|.|  :...|:.::.|.:|...|.|...||.:|.||||.:|.:.|......|...:||
Mouse   899 VSIQNLVKVY--RDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILG 961

  Fly    69 AKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLKELLQLPPAR 133
            .......|.: ...:|..||...|.:.:||:|.|:::.|:.||:::.::.:.:.:...:.|||::
Mouse   962 KDIRSEMSSI-RQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPPSK 1025

  Fly   134 QMIK--QCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITT 196
            ...|  |.|||.||:||.|.|.:...:::||||||.|:||..|..||:.|::..:..  .:|::|
Mouse  1026 LKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGR--TIILST 1088

  Fly   197 HYIEEAK-QANCIGLMRNGVLLAEDTPTNIMIKFGT 231
            |:::||. ..:.|.::.:|.|....:...:..:.||
Mouse  1089 HHMDEADILGDRIAIISHGKLCCVGSSLFLKNQLGT 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 4..245 CDD:440746 70/231 (30%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
Abca1XP_006537617.1 rim_protein 6..2238 CDD:130324 70/231 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.