DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk5

DIOPT Version :8

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster

Alignment Length:297 Identity:113/298 (38%)
Similarity:164/298 (55%) Gaps:15/298 (5%)


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            |.:|:|:.::|||:||.|:|.|:|:|..:||:||....|||..:...|||||.|||.|||.|:|.
  Fly     1 MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVR 65

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQIC----YQTLLGVAYCHKQGCLHRD 172
            |::|....::|.||||.|:    .:|:::.......:...:|    .|.|.|:|:||....||||
  Fly    66 LIDVLHSDKKLTLVFEHCD----QDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSHNVLHRD 126

  Fly   173 IKPENILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCL 236
            :||:|:|:...|::||.|||.||... |.:.|:..|.|.|||.|::|.|...|.|.:|:|:.||:
  Fly   127 LKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCI 191

  Fly   237 FAELV-RGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPA 300
            .|||. .|..|:||...:|||..|.:.||  .|......|.:.....:.||..|.:......:| 
  Fly   192 LAELADAGRPLFPGSDVLDQLMKIFRVLG--TPNEDSWPGVSHLSDYVALPSFPAITSWSQLVP- 253

  Fly   301 KSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDD 337
              :.|....|.|:|.|...|.:|.|.|...:|.||.|
  Fly   254 --RLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTD 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 110/293 (38%)
Pkinase 50..335 CDD:278497 110/291 (38%)
Cdk5NP_477080.1 STKc_CDK5 3..286 CDD:143344 110/292 (38%)
PLN00009 1..288 CDD:177649 112/296 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109351553
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.