DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-theta and dpr10

Sequence 1:NP_723103.1 Gene:DIP-theta FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster

Alignment Length:233 Identity:59/234 (25%)
Similarity:90/234 (38%) Gaps:65/234 (28%)


  Fly   137 QNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSIT-HAEKRAWILRIR 200
            :|:|..|.:.|.|.|.|.:|....:||:|.....|||:..:..|.:.|...: |.:...|.|:|:
  Fly    61 RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIK 125

  Fly   201 DVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILD----------------------------- 236
            ..::.|.|.|.|||:|.|::|....|::|   |::|                             
  Fly   126 WAQQRDAGVYECQISTQPVRSYSVNLNIV---DLIDAETSDIMQQYYNDDAFYIAENRVYQSSND 187

  Fly   237 -------------YPTST-----DMVIREGSNVTLKCAATGSPTPT--ITWRRE---------GG 272
                         .||:|     |:.:.:||.:.|.|....||.|.  |.|..:         ||
  Fly   188 EFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGG 252

  Fly   273 ELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASN 310
            .|......:|...   |.|.|...:.|:.|.|.|..||
  Fly   253 RLKFKTIKSEETK---SILLIYDADLLHSGKYSCYPSN 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 31/94 (33%)
IG_like 137..230 CDD:214653 31/94 (33%)
IG_like 240..324 CDD:214653 24/88 (27%)
IGc2 247..310 CDD:197706 21/74 (28%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
dpr10NP_729591.1 Ig 63..143 CDD:299845 26/80 (33%)
IG_like 210..297 CDD:214653 23/82 (28%)
IGc2 217..287 CDD:197706 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.