DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and GLR2.3

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_001325281.1 Gene:GLR2.3 AraportID:AT2G24710 Length:919 Species:Arabidopsis thaliana

Alignment Length:966 Identity:196/967 (20%)
Similarity:353/967 (37%) Gaps:247/967 (26%)


  Fly     4 LQFLVLL----ALAIASGANEDTLVIKIGAIF-FDT----------EMKLADAFSAALEEVNAIN 53
            |.|.:||    .|....|.|....::.:|.:. .||          .|.::|.:|:        |
plant    30 LFFCILLVFFFCLEFNRGQNNGKTLVDVGVVTDVDTSHSKVVMLCINMSISDFYSS--------N 86

  Fly    54 PALKLDAIKRYVTVDDSIVLQDISCDLIGSGVA-----------AIFGPSSKTNSDIVEVLCNMT 107
            |..:...:   |.|.||      ..|::|:.:|           ||.||.:...:..:..:...:
plant    87 PQFETRLV---VNVGDS------KSDVVGAAIAALDLIKNKQVKAILGPWTSMQAHFLIEIGQKS 142

  Fly   108 GIPHLQFDWHPQQSNRERMNHQLTVNVAPMELFLSAAFSDILASKTFDWKSFTIAYERSSHLIRL 172
            .:|.:.:                            :|.|.||.|.            ||.:.:|.
plant   143 RVPIVSY----------------------------SATSPILTSL------------RSPYFLRA 167

  Fly   173 QHILAWK-QLHKAGIKMQEFERGDDYRILWKRI------NNAREKFV--LLDCPSDILVDV-INA 227
            .:..::: |..||.||:          ..|:.:      |...|..:  |.|...||.|.: ..:
plant   168 TYEDSFQVQPIKAIIKL----------FGWREVVPVYIDNTFGEGIMPRLTDALQDINVRIPYRS 222

  Fly   228 SIGYNMTG---SFNHLFLTNLDTHLSGIDGFY---SRDF-------------------------- 260
            .|..|.|.   |...|.:.|:.|.:..:..:|   ||.|                          
plant   223 VIAINATDHEISVELLKMMNMPTRVFLVHMYYDLASRFFIKAKELGLMEPGYVWILTNGVIDDLS 287

  Fly   261 ---TVAVAAVR----IRTYVPPPVHDEIDVFDNSVDTRFSSLGSQL--------VYDSIVLFYNA 310
               ..||.|:.    |:||:|.  ..:::.|    .:|:.||..::        .||:......|
plant   288 LINETAVEAMEGVLGIKTYIPK--SPDLEKF----RSRWRSLFPRVELSVYGLWAYDATTALAVA 346

  Fly   311 LLEISQRPGFYIPNFSCGR--------GFWQPGPRLVEQMKQITPKMVKPPFKTQRLQINADGQR 367
            :.|.......:......||        |..|.||:|::.:..:..:.:...|:..|      ||.
plant   347 IEEAGTNNMTFSKVVDTGRNVSELEALGLSQFGPKLLQTLLTVQFRGLAGEFRFFR------GQL 405

  Fly   368 EDFNLEVYNPII--DRVTHIWNKEFQLVDFEKLRENSTQALKQ-----KRLQNKEDFSQKPIRYT 425
            :....|:.|.|.  ::....|.:...||.....:.:|..||..     |.:....:....|..:.
plant   406 QPSVFEIVNIINTGEKSIGFWKEGNGLVKKLDQQASSISALSTWKDHLKHIVWPGEADSVPKGWQ 470

  Fly   426 VAT-----RVGKPYFSWREEPEGVHYE---GNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYG 482
            :.|     |:|.|..:...:...|..:   .:....|:.:|....:.:|..:|.::|.:...|..
plant   471 IPTKGKKLRIGVPKRTGYTDLVKVTRDPITNSTVVTGFCIDFFEAVIRELPYDVSYEFIPFEKPD 535

  Fly   483 SYDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKEPPPKADIYA 547
            ...|.  .::.::.|:........:.|.||...|.|.||||.||::.|:.::.....|.|.|...
plant   536 GKTAG--NYNDLVYQVYLGRYDAVVGDTTILVNRSSYVDFTFPFIKSGVGLIVEMTDPVKRDYIL 598

  Fly   548 FLNPYNAEVWLFVMIAMMI---TAFALIFTGRIDQYEWDQPVENVNREMERQNIWHLSNALWLVL 609
            |:.|.:.::||...|:..:   |.:.|       :|:.:.......|       :..|...|...
plant   599 FMKPLSWKLWLTSFISFFLVGCTVWVL-------EYKRNPDFSGPPR-------FQASTICWFAF 649

  Fly   610 GSMLNQGCDLLPR----GLPMRLLTAFWWIFALLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQ 670
            .:|:     ..||    ....|.|...|:...|:::|:|.|.||:.:||.|:...|.|:..|:::
plant   650 STMV-----FAPRERVFSFWARALVIAWYFLVLVLTQSYTASLASLLTSQKLNPTITSMSSLLEK 709

  Fly   671 NKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKG------TYA 729
            .:    |:....||....:..  :.....:.::.|       :..|..|.: ||||      :.|
plant   710 GE----TVGYQRTSFILGKLK--ERGFPQSSLVPF-------DTAEECDEL-LSKGPKKGGVSGA 760

  Fly   730 FLMETTNLQYYVQRNCE-LTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKW 793
            || |...|:.::.:.|. ...:.|.|....:|...|:.:...:::|..||:::|..:..:|...|
plant   761 FL-EIPYLRLFLGQFCNTYKMVEEPFNVDGFGFVFPIGSPLVADVSRAILKVAESPKAMELERAW 824

  Fly   794 FNSNESTC-------DSNVPTIDDGQFDMDSVGGLFVVLIVGVVVGLVIGVAEFLW 842
            |...|.:|       |.| |:....|.|:||    |:.|.|||::..|:.:..|.:
plant   825 FKKKEQSCPDPITNPDPN-PSFTSRQLDIDS----FLFLFVGVLLVCVMALGNFTY 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 83/456 (18%)
ANF_receptor 41..378 CDD:279440 75/413 (18%)
PBP2_iGluR_Kainate 422..795 CDD:270432 84/395 (21%)
Lig_chan 555..822 CDD:278489 63/288 (22%)
GLR2.3NP_001325281.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I1762
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.