DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and grik1a

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:XP_009303592.1 Gene:grik1a ZFINID:ZDB-GENE-030131-6502 Length:919 Species:Danio rerio

Alignment Length:903 Identity:261/904 (29%)
Similarity:440/904 (49%) Gaps:113/904 (13%)


  Fly    24 VIKIGAIFFDTEMKLAD----AFSAALEEVN-----AINPALKLDAIKRYVTVDDSIVLQDISCD 79
            ||:||.||...|.:...    ||..|:..:|     ..|..|..| |:| |.:.||.......||
Zfish    38 VIRIGGIFETRENEPVSMDELAFKFAVTSINRNRTLMPNTTLTYD-IQR-VNLFDSFEASRRVCD 100

  Fly    80 LIGSGVAAIFGPSSKTNSDIVEVLCNMTGIPHLQFDW-HPQQSNRERMNHQLTVNVAPMELFLSA 143
            .:..||||:||||..::...|:.:||...:||:|..| ||...|::    ...:|:.|....:|.
Zfish   101 QLALGVAAVFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKD----NFYINLYPEYTSISR 161

  Fly   144 AFSDILASKTFDWKSFTIAYERSSHLIRLQHILAWKQLHKAGIKMQEF-ERGDDYRILWKRINNA 207
            |..||:.  .:.||..|:.||.|:.|:|:|.::.....:...|::::. ..|.|.|.|.|.:...
Zfish   162 AILDIVI--FYKWKCVTVVYEDSTGLMRMQELIKAPSKNNLKIRIRQLPSGGGDSRPLLKEMKKE 224

  Fly   208 REKFVLLDCPSDILVDVINASIGYNMTGSFNHLFLTNLDTHLSGIDGF-YSRDFTVAVAAVRI-- 269
            :|.:|:.||...:..:::...:...|...:.|.|.|.||.....::.: ||   .|.:.|.|:  
Zfish   225 KEFYVIFDCSYQVAAELLKQLMSMGMMTEYYHFFFTTLDLFALDLEPYRYS---GVNMTAFRLLN 286

  Fly   270 ----------------RTYVPPPVHDEIDVFDNSVDTRFSSLGSQLVYDSIVLFYNALLEI---S 315
                            |...||...              |.|.|.::..:..|.|:|:..:   |
Zfish   287 LDDSYVASVIQKWSMERQLAPPKPE--------------SGLMSGIMTTAAALMYDAVFMVAVAS 337

  Fly   316 QR-PGFYIPNFSCGRGF-WQPGPRLVEQMKQITPKMVKPPFKTQRLQIN-ADGQREDFNLEVYNP 377
            || ....:.:..|.|.. |:.|||.:...|:     .:....|.|:.:| .||.|::|||::.:.
Zfish   338 QRATQMTVSSLQCHRHKPWRYGPRFMNLFKE-----AQWDGLTGRIVLNKTDGLRKEFNLDLISL 397

  Fly   378 IID-----------RVTHIWNK-----EFQLVDFEKLRENS--TQALKQKRLQNKEDFSQKPIRY 424
            ..|           |...:|.|     .:..::..::::|.  |.:|..:.|             
Zfish   398 KEDGTAKRVADGASRPNKLWTKIGVWNSYTGLNLTEIKDNKNITDSLANRTL------------- 449

  Fly   425 TVATRVGKPYFSWREEPEGVHYEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTD 489
            .|.|.:..||..:::..:.::  ||:|||||.:||:..|:....|.:..:.|.|.|||:.: :..
Zfish   450 IVTTILENPYVMYKKSDKVLY--GNDRFEGYCLDLLKELSNILGFTYEVKLVTDGKYGAQN-DKG 511

  Fly   490 EWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKEPPPKADIYAFLNPYNA 554
            ||:|::|:|||:.|.:.:..||||..|..|:||:.|||.||||||..|.......:::||||...
Zfish   512 EWNGMVRELIDHIADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLTP 576

  Fly   555 EVWLFVMIAMMITAFALIFTGRIDQYEWDQPVE-NVNREMERQNIWHLSNALWLVLGSMLNQGCD 618
            ::|::|::|.:..:..|....|...|||..|.. |.:.|:...| :.|.|:||..:.:::.||.:
Zfish   577 DIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPSSEVVENN-FTLLNSLWFGVAALMRQGSE 640

  Fly   619 LLPRGLPMRLLTAFWWIFALLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQNKVQFGTIRGGAT 683
            |:|:.|..|:|...||.|.|:|..:|.|.||||:|..::...|.|..||..|.::::|.:|.|:|
Zfish   641 LMPKALSTRILGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTRIEYGAVRDGST 705

  Fly   684 SVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELT 748
            ..:|.:|..:.....|..|.|.|..|..||:::|:.||..:  .||.|||:|:::|..||||.||
Zfish   706 MTFFKKSKISTYEKMWAFMSSRKNTALVKNSKDGITRVLTT--DYALLMESTSIEYITQRNCNLT 768

  Fly   749 QIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSNESTCDSNVPTIDDGQ- 812
            |:|.....|.||:..|:.:.:|..:::.||:|.|.|:|..::.||:..|      ..|..|..: 
Zfish   769 QVGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGN------GCPEEDSKEA 827

  Fly   813 --FDMDSVGGLFVVLIVGVVVGLVIGVAEFLWHVQRISVKEKIPPMLALKAEFYFVIR 868
              ..::::||:|:||..|:|:.:.:.:.||::...:.|..|:.....|:..:....:|
Zfish   828 SALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSHKNSDIEECVSFSAVMEDLGISLR 885

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 105/419 (25%)
ANF_receptor 41..378 CDD:279440 96/369 (26%)
PBP2_iGluR_Kainate 422..795 CDD:270432 134/374 (36%)
Lig_chan 555..822 CDD:278489 89/271 (33%)
grik1aXP_009303592.1 Periplasmic_Binding_Protein_Type_1 37..432 CDD:299141 107/424 (25%)
ANF_receptor 57..398 CDD:279440 96/371 (26%)
Periplasmic_Binding_Protein_Type_2 446..815 CDD:304360 135/388 (35%)
Lig_chan 577..846 CDD:278489 93/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114469823
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D60688at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.