DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and grik1b

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:XP_690040.5 Gene:grik1b ZFINID:ZDB-GENE-070821-1 Length:906 Species:Danio rerio

Alignment Length:911 Identity:267/912 (29%)
Similarity:450/912 (49%) Gaps:121/912 (13%)


  Fly     3 GLQFLVLLALA-IASGANEDTLVIKIGAIFFDTEMKLAD----AFSAALEEVN-----AINPALK 57
            |:.|::|..:| :...|.:   |::||.||...|.:...    ||..|:..:|     ..|..|.
Zfish    44 GVSFILLCLMAEVGLSAQQ---VLRIGGIFETLENEPISVEELAFKFAVTNINRNRTLMPNTTLT 105

  Fly    58 LDAIKRYVTVDDSIVLQDISCDLIGSGVAAIFGPSSKTNSDIVEVLCNMTGIPHLQFDW-HPQQS 121
            .| |:| :.:.||......:||.:..||||:||||..::...|:.:||...:||:|..| ||...
Zfish   106 YD-IQR-INLFDSFEASRRACDQLALGVAAVFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVD 168

  Fly   122 NRERMNHQLTVNVAPMELFLSAAFSDILASKTFDWKSFTIAYERSSHLIRLQHILAWKQLHKAGI 186
            |::    ...:|:.|....:|.|..||:  :.:.||:.|:.||.::.|||||.::.....:...|
Zfish   169 NKD----SFYINLYPDYASISRAVLDIV--QFYKWKAVTVVYEDATGLIRLQELIKAPSRYSIKI 227

  Fly   187 KMQEFERGD-DYRILWKRINNAREKFVLLDCPSDILVDVINASIGYNMTGSFNHLFLTNLDTHLS 250
            |:::...|. |.|.|.|.:...:|..|:.||......||:...:...|...:.|.|.|.||.:..
Zfish   228 KIRQLPTGSKDARPLLKEMKKGKEFCVIFDCSYQTAADVLKQLLSMGMMTEYYHFFFTTLDLYSL 292

  Fly   251 GIDGF-YSRDFTVAVAAVRI------------------RTYVPPPVHDEIDVFDNSVDTRFSSLG 296
            .::.| ||   .|.:...|:                  |...||  ..|..:.|..:.|.     
Zfish   293 DLEPFRYS---GVNMTGFRLLNIDNPQVASVVEKWSMERLQAPP--KPETGLQDGMMTTE----- 347

  Fly   297 SQLVYDSIVLFYNALLEISQRPGFYIPNFSCGRGF-WQPGPRLVEQMKQ-----ITPKMVKPPFK 355
            :.|:||::.:...|....||   ..:.:..|.|.. |:.|.|.:...|:     :|.:::     
Zfish   348 AALMYDAVYMVAAASQRASQ---ITVSSLQCHRHKPWRFGSRFISMFKEAQWNGLTGQII----- 404

  Fly   356 TQRLQIN-ADGQREDFNLEV----------------YNPIIDRVTHIWNKEFQLVDFEKLRENST 403
                 || .||.|:||:|::                :|.:..:: .:||....|        |.|
Zfish   405 -----INKTDGLRKDFDLDIISLKEDGLEKPLESGRFNKVWKKI-GVWNSNTGL--------NLT 455

  Fly   404 QALKQKRLQNKEDFSQKPIRYTVATRVGKPYFSWREEPEGVHYEGNERFEGYAVDLIYMLAQECK 468
            .:.|.|.....:..:.:.:  .|.|.:..||..:::..:.::  ||:|||||.:||:..|:....
Zfish   456 DSNKDKNTNVTDSMANRTL--IVTTILENPYVMYKKSDKPLY--GNDRFEGYCLDLLKELSNILG 516

  Fly   469 FDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISI 533
            |.:..:.|.|.|||:.: :..||:|::|:|||:.|.:.:..||||..|..|:||:.|||.|||||
Zfish   517 FSYEVKLVTDGKYGAQN-DKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISI 580

  Fly   534 LSYKEPPPKADIYAFLNPYNAEVWLFVMIAMMITAFALIFTGRIDQYEWDQPVE-NVNREMERQN 597
            |.:|.......:::||||.:.::|::|::|.:..:..|....|...|||..|.. |.:.::...|
Zfish   581 LYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENN 645

  Fly   598 IWHLSNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFALLISQTYIAKLAAFITSSKIAGDIG 662
             :.|.|::|..:|:::.||.:|:|:.|..|::...||.|.|:|..:|.|.||||:|..::...|.
Zfish   646 -FTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPID 709

  Fly   663 SLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKGT 727
            |..||..|.|:::|.:|.|:|..:|.:|..:.....|..|.|.|..|..|||.||:.||..:  .
Zfish   710 SADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREGIQRVLTT--D 772

  Fly   728 YAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNK 792
            ||.|||:|:::|..||||.|||||.....|.||:..|:.:.:|..:::.||:|.|.|:|..::.|
Zfish   773 YALLMESTSIEYISQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEK 837

  Fly   793 WFNSNESTCDSNVPTIDDGQ---FDMDSVGGLFVVLIVGVVVGLVIGVAEFLW------HVQRIS 848
            |:..|      ..|..|..:   ..::::||:|:||..|:|:.:.:.:.||::      .::.:|
Zfish   838 WWRGN------GCPEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNLDIEEVS 896

  Fly   849 V 849
            |
Zfish   897 V 897

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 107/420 (25%)
ANF_receptor 41..378 CDD:279440 99/386 (26%)
PBP2_iGluR_Kainate 422..795 CDD:270432 136/374 (36%)
Lig_chan 555..822 CDD:278489 91/271 (34%)
grik1bXP_690040.5 Periplasmic_Binding_Protein_Type_1 62..455 CDD:299141 109/436 (25%)
ANF_receptor 80..423 CDD:279440 98/374 (26%)
Periplasmic_Binding_Protein_Type_2 471..840 CDD:304360 136/377 (36%)
Lig_chan 602..871 CDD:278489 95/278 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114469753
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D60688at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.