DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and Ir75c

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_649013.3 Gene:Ir75c FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster

Alignment Length:546 Identity:119/547 (22%)
Similarity:214/547 (39%) Gaps:114/547 (21%)


  Fly   354 FKTQRLQINAD---GQREDFNLEVYNPIIDRVTHIWNKEFQLVDFE--------KLRENSTQALK 407
            |:...|.:|||   ..|||....:.:.:.::.:|:..|....||..        :::|..::...
  Fly   119 FEGANLSLNADVTYVSREDEERFILHDVYNKGSHLGGKLNITVDQTLQCNRSHCQVKEYLSELHL 183

  Fly   408 QKRLQNKEDFSQKPIRYTVATRVGKPYFSWREE------------PEGVHYEGN------ERFEG 454
            :.|||::.|.|....|......| .|..|..||            .:.:...||      :...|
  Fly   184 RPRLQHRMDLSSVTFRLAALVSV-LPINSSEEELLEFLNSDRDSHMDSISRIGNRLIMHTQEILG 247

  Fly   455 YAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSV 519
            :.:..|:     |              |::... |.:.|.|..|.:.:|:  :|           
  Fly   248 FKLHYIW-----C--------------GTWSVQ-DAFGGAIGMLTNESAE--LC----------- 279

  Fly   520 VDFTVPFMQLGISILSYKEP---------------PPKADIYA--FLNPYNAEVWLFVMIAMMIT 567
               |.||:. ..:.|.|..|               |..|.|.|  ||.|:...|| |....::|.
  Fly   280 ---TTPFVP-SWNRLHYLHPMTEQAQFRAVCMFRTPHNAGIKAAVFLEPFMPSVW-FAFAGLLIF 339

  Fly   568 AFALIFTGRIDQYEWDQPVENVNREMER--QNIWHLSNALWLVLGSMLNQGCDLLPRGLPMRLLT 630
            |..|::.....:..|          |:|  ..|..|.::..:..|:...||..|:|:....||..
  Fly   340 AGVLLWMIFHLERHW----------MQRCLDFIPSLLSSCLISFGAACIQGSYLMPKSAGGRLAF 394

  Fly   631 AFWWIFALLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQN-KVQFGTIRGGATSVYFSESNDTD 694
            ....:.:.|:...|.:.:.:.:..|.:..:|.::..|.|.: .|.|.|:  ..|..|...|...|
  Fly   395 IAVMLTSFLMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSLDVGFDTV--PFTKTYLVSSPRPD 457

  Fly   695 NRMAWNKMLSFK--PDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNC---ELTQIGESF 754
            .|..:.:.:..|  |::...:.||||.||:...| :.:..|.:.:.::|:::.   |::.:.|..
  Fly   458 IRSLYKQKVESKRDPNSVWLSPEEGVIRVRDQPG-FVYTSEASFMYHFVEKHYLPREISDLNEII 521

  Fly   755 GEKH---YGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSNESTCDSNVPTIDDGQFDMD 816
            ....   ||: |.||:.:|..|:...:|:.|.|...| ::::|:..:....||...|   |..|:
  Fly   522 LRPESAVYGM-VHLNSTYRQLLTQLQVRMLETGITSK-QSRFFSKTKLHTFSNSFVI---QVGME 581

  Fly   817 SVGGLFVVLIVGVVVGLVIGVAEFLW 842
            ....||:.|:|...:.|:|.:.|..|
  Fly   582 YAAPLFISLLVAYFLALLILILEICW 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 10/42 (24%)
ANF_receptor 41..378 CDD:279440 8/27 (30%)
PBP2_iGluR_Kainate 422..795 CDD:270432 88/419 (21%)
Lig_chan 555..822 CDD:278489 63/278 (23%)
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 54/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113148329
eggNOG 1 0.900 E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18966
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.