DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and GRIK5

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:XP_011525167.1 Gene:GRIK5 HGNCID:4583 Length:982 Species:Homo sapiens

Alignment Length:887 Identity:254/888 (29%)
Similarity:438/888 (49%) Gaps:82/888 (9%)


  Fly     5 QFLVLLALAIASGANEDTLVIKIGAIFFDTEM-----KLADAFSAALEEVNAINPALKLDAIKRY 64
            :.|:||.:|.||.:.:....:::.||..|..:     :|  |.:.|.|::|.|   :::.| |..
Human     4 ELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERL--ALALAREQINGI---IEVPA-KAR 62

  Fly    65 VTVD------DS-IVLQDISCDLIGSGVAAIFGPSSK-TNSDIVEVLCNMTGIPHLQFDWHPQQS 121
            |.||      || ....|..|.::..||.::.||||. .::..|..:|....|||::..  |:::
Human    63 VEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVG--PEET 125

  Fly   122 NRERMNHQLTVNVAPMELFLSAAFSDILASKTFDWKSFTIAYERSSHLIRLQHILAWKQLHKAGI 186
            .|.:.....:|::.|....:|.|.|.||  |:|::.|.::...::..|:||:.::....:.|..:
Human   126 PRLQYLRFASVSLYPSNEDVSLAVSRIL--KSFNYPSASLICAKAECLLRLEELVRGFLISKETL 188

  Fly   187 KMQEFERGDDYRILWKRINNAREKFVLLDCPSDILVDVINASIGYNMTGSFNHLFLTNLDTHLSG 251
            .::..:...|...|.|.|.:.:...:::|..:.|...::..:....||.:|....||.:|..:..
Human   189 SVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILH 253

  Fly   252 IDGFYSRDFTVAVAAVRIRTYVPPPVHDEIDVFDNSVDTRF-----------SSLGSQLVYDSIV 305
            :||.......:...::...::   |.:.|   |..|::..:           .:|.:.|::|::.
Human   254 LDGIVEDSSNILGFSMFNTSH---PFYPE---FVRSLNMSWRENCEASTYLGPALSAALMFDAVH 312

  Fly   306 LFYNALLEISQRPGFYIPNFSC-GRGFWQPGPRLVEQMKQITPKMVKPPFKTQRLQINADGQRED 369
            :..:|:.|:::.....:...:| ....|..|..|:..:     :||:....|.|::.|:.|||.:
Human   313 VVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYL-----RMVEYDGLTGRVEFNSKGQRTN 372

  Fly   370 FNLEVYNPIIDRVTH----IWNKEFQL-VDFEKLRENSTQALKQKRLQNKEDFSQKPIRYTVATR 429
            :.|.:...  .|..|    :|.....| ::...|..|.:|.|..|.|             .|.|.
Human   373 YTLRILEK--SRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTL-------------VVTTI 422

  Fly   430 VGKPYFSWREEPEGVHYEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGI 494
            :..||...|  |......|||||||:.||::..||:..:|.:....|.|..||:.:.| ..|.|:
Human   423 LENPYVMRR--PNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPN-GSWTGM 484

  Fly   495 IRQLID-NNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKEPPPKADIYAFLNPYNAEVWL 558
            :.:||: ..|.:.:...|||..|..|:||:.|||.||||||.......|...::||:|::..|||
Human   485 VGELINRQKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWL 549

  Fly   559 FVMIAMMITAFALIFTGRIDQYEWDQPVENVN-REMERQNIWHLSNALWLVLGSMLNQGCDLLPR 622
            |:::|.:..:..|....|:..|||..|...:. |....:|.:.|.|:||..:|..:.||.:::||
Human   550 FMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPR 614

  Fly   623 GLPMRLLTAFWWIFALLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQNKVQFGTIRGGATSVYF 687
            .|..|.::..||.|.|:|..:|.|.||||:|..::...:.|..||.||..:::|||..|:|..:|
Human   615 ALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFF 679

  Fly   688 SESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELTQIGE 752
            ..|.....:..||.|.|.:|..|.|:.|||:.||..|:  ||||:|:|..:|:.:.||.|||||.
Human   680 QNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSR--YAFLLESTMNEYHRRLNCNLTQIGG 742

  Fly   753 SFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSNESTCDSNVPTIDDGQ---FD 814
            ....|.|||.:||.:.||..:::.||:|.|...|..|:.||:....  |    |..:|.:   ..
Human   743 LLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRKWWEGGR--C----PKEEDHRAKGLG 801

  Fly   815 MDSVGGLFVVLIVGVVVGLVIGVAEFLWHVQRISVKEKIPPM 856
            |:::||:|:|||.|:::.:.:.|.||:|..:|.:..|:.|.:
Human   802 MENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEETPAL 843

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 85/397 (21%)
ANF_receptor 41..378 CDD:279440 77/357 (22%)
PBP2_iGluR_Kainate 422..795 CDD:270432 139/375 (37%)
Lig_chan 555..822 CDD:278489 97/271 (36%)
GRIK5XP_011525167.1 PBP1_iGluR_Kainate_KA1_2 25..399 CDD:107389 85/397 (21%)
ANF_receptor 42..379 CDD:279440 78/358 (22%)
Periplasmic_Binding_Protein_Type_2 414..785 CDD:304360 141/389 (36%)
Lig_chan 546..816 CDD:278489 102/278 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112185607
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.