DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and GRIK3

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_000822.2 Gene:GRIK3 HGNCID:4581 Length:919 Species:Homo sapiens

Alignment Length:915 Identity:266/916 (29%)
Similarity:443/916 (48%) Gaps:103/916 (11%)


  Fly    24 VIKIGAIFFDTEMKLADAFSAALEEVNAINPALKLDA--IKRYVTV---------------DDSI 71
            ||:||.||     :.||..:|  :.:||...|.:..|  |.|..|:               .||.
Human    35 VIRIGGIF-----EYADGPNA--QVMNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDSF 92

  Fly    72 VLQDISCDLIGSGVAAIFGPSSKTNSDIVEVLCNMTGIPHLQFDW-HPQQSNRERMNHQLTVNVA 135
            .....:||.:..||.||||||..:.::.|:.:||...:||:|..| |....|::    ...||:.
Human    93 EATKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKD----TFYVNLY 153

  Fly   136 PMELFLSAAFSDILASKTFDWKSFTIAYERSSHLIRLQHILAWKQLHKAGIKMQEFE-RGDDYRI 199
            |....||.|..|::  :...|:|.|:.|:.|:.|||||.::.....:...:|:::.. ..||.|.
Human   154 PDYASLSHAILDLV--QYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRP 216

  Fly   200 LWKRINNAREKFVLLDCPSDILVDVINASIGYNMTGSFNHLFLTNLDTHLSGIDGF-YSRDFTVA 263
            |.|.:...||..::.||...:...::..::...|...:.|...|.||.:...::.: ||   .|.
Human   217 LLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYS---GVN 278

  Fly   264 VAAVRIRTYVPPPVHDEIDVFD----NSVDTRFSSLGSQLVYDSIVLFYNALLEIS---QR-PGF 320
            :...||.....|.|...::.:.    .:.....|.|...::.....|.|:|:..:|   || |..
Human   279 LTGFRILNVDNPHVSAIVEKWSMERLQAAPRSESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQM 343

  Fly   321 YIPNFSCGR-GFWQPGPRLVEQMKQITPKMVKPPFKTQRLQIN-ADGQREDFNLEVYNPIIDRV- 382
            .:.:..|.| ..|:.|.|.:..:|:...:.:     |.|:..| ..|.|.||:|::.:...|.: 
Human   344 TVNSLQCHRHKAWRFGGRFMNFIKEAQWEGL-----TGRIVFNKTSGLRTDFDLDIISLKEDGLE 403

  Fly   383 -THIWNKE--FQLVDFEKLR-ENSTQALKQKRLQNKEDFSQKPIRYTVATRVGKPYFSWREEPEG 443
             ..:|:..  ..:.:..|.| .|.|.:|..:.|             .|.|.:.:|:..:|:....
Human   404 KVGVWSPADGLNITEVAKGRGPNVTDSLTNRSL-------------IVTTVLEEPFVMFRKSDRT 455

  Fly   444 VHYEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGIC 508
            ::  ||:|||||.:||:..||....|.:....|.|.|||:.| :..:|:|::::|||:.|.:.:.
Human   456 LY--GNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQD-DKGQWNGMVKELIDHKADLAVA 517

  Fly   509 DLTITQARRSVVDFTVPFMQLGISILSYKEPPPKADIYAFLNPYNAEVWLFVMIAMMITAFALIF 573
            .||||..|...:||:.|||.||:|||..|.......:::||||.:.::|::|::|.:..:..|..
Human   518 PLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFV 582

  Fly   574 TGRIDQYEW-DQPVENVNREMERQNIWHLSNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFA 637
            ..|...||| |....|...|:...| :.|.|:.|..:||::.||.:|:|:.|..|::...||.|.
Human   583 IARFSPYEWYDAHPCNPGSEVVENN-FTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFT 646

  Fly   638 LLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKM 702
            |:|..:|.|.||||:|..::...|.|..||..|.|:::|.::.|||..:|.:|..:.....| ..
Human   647 LIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMW-AF 710

  Fly   703 LSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNA 767
            :|.||.|..||||||:.|...:  .||.|||:|.::|..||||.|||||.....|.|||..|:.:
Human   711 MSSKPSALVKNNEEGIQRALTA--DYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGS 773

  Fly   768 DFRSNLSVGILRLSERGELFKLRNKWFNSNESTCDSNVPTIDDGQFDMDSVGGLFVVLIVGVVVG 832
            .:|..:::.||:|.|..:|..::.||:..:....:.|.   :.....:..:||:|:||..|:|:.
Human   774 PYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEENK---EASALGIQKIGGIFIVLAAGLVLS 835

  Fly   833 LVIGVAEFLWHVQRISVKEKIPPMLALKAEFYFVIRFWLT------RKP-------------LHT 878
            :::.|.||::.:::.:.:|:......:..|    |||.||      .||             :||
Human   836 VLVAVGEFVYKLRKTAEREQRSFCSTVADE----IRFSLTCQRRVKHKPQPPMMVKTDAVINMHT 896

  Fly   879 YRQSR 883
            :...|
Human   897 FNDRR 901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 99/401 (25%)
ANF_receptor 41..378 CDD:279440 91/367 (25%)
PBP2_iGluR_Kainate 422..795 CDD:270432 136/374 (36%)
Lig_chan 555..822 CDD:278489 91/268 (34%)
GRIK3NP_000822.2 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388 101/403 (25%)
ANF_receptor 55..398 CDD:279440 89/357 (25%)
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 137/388 (35%)
Lig_chan 564..832 CDD:278489 95/275 (35%)
Glutamate binding. {ECO:0000250} 690..692 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113559669
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D60688at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.