DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and GRID2

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:XP_011530195.2 Gene:GRID2 HGNCID:4576 Length:1035 Species:Homo sapiens

Alignment Length:888 Identity:199/889 (22%)
Similarity:363/889 (41%) Gaps:177/889 (20%)


  Fly    66 TVDDSIVLQDISCDLIGSGVAAIFGPSSKTNSDIVEVLCNMTGIPHLQFDWHPQQS--------- 121
            |...:..|...:|:|:..|:.|:......|::..::.|.:...||||..    |:|         
Human    83 TASPATALPQKTCELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFI----QRSTAGTPRSGC 143

  Fly   122 --NRERMNHQLTVNVAPMELFLSAAFSDILASKTFDWKSFTIAYERSSHLIRLQHILAWKQLHKA 184
              .|...|...|::|.| .::|......::..  :.|:.|.|.|:....:..:|..|........
Human   144 GLTRSNRNDDYTLSVRP-PVYLHDVILRVVTE--YAWQKFIIFYDSEYDIRGIQEFLDKVSQQGM 205

  Fly   185 GIKMQEFERG---------DDYRILWKRINNARE---KFVLLDCPS---DILVDVINASIGYNMT 234
            .:.:|:.|..         |..||  :.:|..|:   :.:|:..|:   ..:.:|:..    |:.
Human   206 DVALQKVENNINKMITTLFDTMRI--EELNRYRDTLRRAILVMNPATAKSFITEVVET----NLV 264

  Fly   235 GSFNHLFLTNLDTHLSGIDGFYSRD---FTVAVAAVRIRTYVPPPVH-----------------D 279
            ....|..:.|.:.:...:.....|.   .|:      ||...|.|.:                 |
Human   265 AFDCHWIIINEEINDVDVQELVRRSIGRLTI------IRQTFPVPQNISQRCFRGNHRISSTLCD 323

  Fly   280 EIDVFDNSVDTRFSSLGSQLVYDSIVLFYNAL-LEISQRPGFYIPNFSCGRGF---WQPGPRLVE 340
            ..|.|..:::     :.:..:||:::|..||. .::..|....:.:.||.|..   ||.|..::|
Human   324 PKDPFAQNME-----ISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLE 383

  Fly   341 QMKQITPKMVKPPFKTQRLQINADGQREDFNLEV----YNPIIDRVTH----------------- 384
            .:|:.....:     |..|:...:|...:.:.|:    |...:.|...                 
Human   384 TIKKGGVSGL-----TGELEFGENGGNPNVHFEILGTNYGEELGRGVRKNERIRPQGSTGKIWPQ 443

  Fly   385 --IWNKEFQLVDFEKLRENSTQALKQKRLQNKEDFSQKPIRYTVATRVGKPYFSWREEPEGVHYE 447
              .||....|          ..:|..|:|:|    :.:.:...|.|.:.:|:....|...|    
Human   444 LGCWNPVTGL----------NGSLTDKKLEN----NMRGVVLRVVTVLEEPFVMVSENVLG---- 490

  Fly   448 GNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTI 512
            ..::::|:::|::..|:....|::......|:|||| ......|:|::.:|:...|.|||..|||
Human   491 KPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGS-PQEDGTWNGLVGELVFKRADIGISALTI 554

  Fly   513 TQARRSVVDFTVPFMQLGISILSYKEPPPKADIYAFLNPYNAEVWLFVMIAMMITAFALIFTGRI 577
            |..|.:|||||..:|...:.:| .:......|::|.|.|::..:|..:...:::... |::.   
Human   555 TPDRENVVDFTTRYMDYSVGVL-LRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGL-LVYL--- 614

  Fly   578 DQYEWDQPVENVNREMERQNIWHLSNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFALLISQ 642
              ..|..|   ...:|.......|.|::|.|.||.:.||.::....|..|::...||:|||::..
Human   615 --LNWLNP---PRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVIS 674

  Fly   643 TYIAKLAAFITSSKIAGDIGSLHDLVDQNKVQFGTIRGGAT---------------SVY------ 686
            :|.|.||||:|.::|...|.||.||..|.::.:||:...|.               |:|      
Human   675 SYTANLAAFLTITRIESSIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRM 739

  Fly   687 FSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYV--QRNCELTQ 749
            .:.||.::|.:.              .::.|:.:||.  |.|||:.:...|:|..  ..:|....
Human   740 INRSNGSENNVL--------------ESQAGIQKVKY--GNYAFVWDAAVLEYVAINDPDCSFYT 788

  Fly   750 IGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSNESTCD--SNVPTID-DG 811
            ||.:..::.||||:...:.:|...|..||.|.:.|::..|::||:..| ..||  |:|.|.. .|
Human   789 IGNTVADRGYGIALQHGSPYRDVFSQRILELQQNGDMDILKHKWWPKN-GQCDLYSSVDTKQKGG 852

  Fly   812 QFDMDSVGGLFVVLIVGVVVGLVIGVAEFLWHVQ---RISVKE 851
            ..|:.|..|:|.:|..|:|:...|.:.|..|:.:   |:..||
Human   853 ALDIKSFAGVFCILAAGIVLSCFIAMLETWWNKRKGSRVPSKE 895

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 71/400 (18%)
ANF_receptor 41..378 CDD:279440 67/366 (18%)
PBP2_iGluR_Kainate 422..795 CDD:270432 104/396 (26%)
Lig_chan 555..822 CDD:278489 77/293 (26%)
GRID2XP_011530195.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112362226
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.