DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GluRIIB and Grid1

Sequence 1:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_032192.2 Gene:Grid1 MGIID:95812 Length:1009 Species:Mus musculus

Alignment Length:896 Identity:213/897 (24%)
Similarity:389/897 (43%) Gaps:132/897 (15%)


  Fly    24 VIKIGAIFFDTEMKLADAFSAALEEVNAINPALKLDAIKRYVTVDDS----IVLQDISCDLIGSG 84
            :|.|||||.:...|....|..|:.:::..:..|:.:.|...:.|.::    ..:|: :|||:..|
Mouse    23 IIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQE-ACDLMTQG 86

  Fly    85 VAAIFGPSSKTNSDIVEVLCNMTGIPHLQFDWHPQQSNRERMNHQLTVNVAP-MELFLSAA---- 144
            :.|:...:...:::.::.|.:...||||....:|..|.|...:    :|.:| .|.:..|:    
Mouse    87 ILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACH----LNPSPDGEAYTLASRPPV 147

  Fly   145 -FSDILASKTFD--WKSFTIAYERSSHLIRLQHILAWKQLHKAG--IKMQEFERGDDY------- 197
             .:|::.....:  |:.|.:.|:....:..||..|  .|..:.|  :.:|:.::...:       
Mouse   148 RLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFL--DQASRLGLDVSLQKVDKNISHVFTSLFT 210

  Fly   198 RILWKRINNARE---KFVLLDCPSDILVDVINASIGYNMTGSFNHLFLTN---LDTHLSGIDGFY 256
            .:..:.:|..|:   :.:||..|.. ....||.::..|:....:|....|   .|..:  :|..:
Mouse   211 TMKTEELNRYRDTLRRAILLLSPQG-AHSFINEAVETNLASKDSHWVFVNEEISDPEI--LDLVH 272

  Fly   257 SRDFTVAVAAVRIRTYVPPPVHDEIDVFDNSVDTRFSSL--------------GSQLVYDSIVLF 307
            |     |:..:.:...:.|...|......|  :.|.|||              .:..:|||:::.
Mouse   273 S-----ALGRMTVVRQIFPSAKDNQKCMRN--NHRISSLLCDPQEGYLQMLQISNLYLYDSVLML 330

  Fly   308 YNAL-LEISQRPGFYIPNFSCGRGF---WQPGPRLVEQMKQ-----ITPKMVKPPFKTQRLQINA 363
            .||. .::..|....:.:.:|.|..   |..|..:::.:|:     :|..|              
Mouse   331 ANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVM-------------- 381

  Fly   364 DGQREDFNLEVYNPIID------RVTHIWNKEFQLV---DFEKLRENSTQALKQ-KRLQNKEDFS 418
                 :|..:..||.:.      ..:..:.|:.:.:   |.||....|.|.... .|||.     
Mouse   382 -----EFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQG----- 436

  Fly   419 QKPIRYTVATRVGKPYFSWREEPEGVHYEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGS 483
               :...|.|.:.:|:....|...|    ..:|::|:::|::..||:...|.:......|.:||.
Mouse   437 ---LTLKVVTVLEEPFVMVAENILG----QPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGH 494

  Fly   484 YDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKEPPPKADIYAF 548
            ...|| .|:|:|.:||...|.:.|..:|||..|.|||||:..:|...:.|| .|:|..|..|::.
Mouse   495 QLHNT-SWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGIL-IKKPEEKISIFSL 557

  Fly   549 LNPYNAEVWLFVMIAMMITAFALIFTGRIDQYEWDQPVENVNREMERQNI-WHLSNALWLVLGSM 612
            ..|::..||..:..|:.:....:....||      |.|.:.:....|.:. ..|.:|:|:|.|:.
Mouse   558 FAPFDFAVWACIAAAIPVVGVLIFVLNRI------QAVRSQSATQPRPSASATLHSAIWIVYGAF 616

  Fly   613 LNQGCDLLPRGLPMRLLTAFWWIFALLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQNKVQFGT 677
            :.||.:.....:.||::...||:|.|::..:|.|.||||:|.|::...|.:..||..|.::.:||
Mouse   617 VQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQLEMSYGT 681

  Fly   678 IRGGATSVYFSESN----DTDNRMA--WNKM-LSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETT 735
            :|..|...||....    :.|:..|  |..: .:...|....|..||:.:.|  ||.||||.:..
Mouse   682 VRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSNPSEGIRKAK--KGNYAFLWDVA 744

  Fly   736 NLQY--YVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNSNE 798
            .::|  ....:|.:|.||.|...|.||||:...:.:|...|..||.|.:.|:|..|:.||: .:.
Mouse   745 VVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW-PHT 808

  Fly   799 STCD--SNVPTIDDGQ-FDMDSVGGLFVVLIVGVVVGLVIGVAEFLWHVQR 846
            ..||  |:..|..:|: ..:.|..|:|.:|.:|:::..::...|..|:..|
Mouse   809 GRCDLTSHSSTQTEGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNR 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 77/423 (18%)
ANF_receptor 41..378 CDD:279440 70/387 (18%)
PBP2_iGluR_Kainate 422..795 CDD:270432 114/383 (30%)
Lig_chan 555..822 CDD:278489 81/280 (29%)
Grid1NP_032192.2 Interaction with CBLN1. {ECO:0000269|PubMed:27418511} 21..436 86/449 (19%)
PBP1_iGluR_delta_1 25..423 CDD:107387 80/434 (18%)
PBP2_iGluR_delta_1 436..806 CDD:270448 114/393 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114261538
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.