DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Oscillin and Gnpda1

Sequence 1:NP_001245894.1 Gene:Oscillin FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036067.2 Gene:Gnpda1 MGIID:1347054 Length:289 Species:Mus musculus

Alignment Length:259 Identity:200/260 (77%)
Similarity:226/260 (87%) Gaps:0/260 (0%)


  Fly     1 MRLVILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYKELIEFHKQGKVSFQY 65
            |:|:|||......:|||||:..||..|.|..|:||.|||||||||||.|::|||::|.|.:||||
Mouse     1 MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTPLGCYQKLIEYYKNGDLSFQY 65

  Fly    66 VKTFNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAADLVAECNKFEDQIREAGG 130
            ||||||||||||.|||.||||.||||||||||||.|:|.||||||||||.|||:.||::|:.|||
Mouse    66 VKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAADLQAECDAFEEKIQAAGG 130

  Fly   131 VELFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVGTVMD 195
            :|||:||||||||||||||||||||||||||||.||:.|||||||.|::|||..|||||||||||
Mouse   131 IELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGDLAKVPTMALTVGVGTVMD 195

  Fly   196 SKEVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHANTLMICDEDATLELRVKTVKYFKGIL 259
            :||||||||||||||||||||||||||||||||||||..|:.:|||||||||:|||||||||::
Mouse   196 AKEVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLM 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 195/252 (77%)
Gnpda1NP_036067.2 SugarP_isomerase 1..253 CDD:294243 195/252 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C286486246
eggNOG 1 0.900 E1_COG0363
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 426 1.000 Inparanoid score I1732
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1425290at2759
OrthoFinder 1 1.000 FOG0002194
OrthoInspector 1 1.000 T616741
orthoMCL 1 0.900 OOG5_128189
Panther 1 1.100 LDO PTHR11280
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2549
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.