DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Oscillin and GNPDA2

Sequence 1:NP_001245894.1 Gene:Oscillin FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_612208.1 Gene:GNPDA2 HGNCID:21526 Length:276 Species:Homo sapiens

Alignment Length:259 Identity:200/260 (77%)
Similarity:229/260 (88%) Gaps:0/260 (0%)


  Fly     1 MRLVILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYKELIEFHKQGKVSFQY 65
            ||||||:..|...:|||||:..||..|:|..||||.|||||||||||.||:|||:||.|.:||:|
Human     1 MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKY 65

  Fly    66 VKTFNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAADLVAECNKFEDQIREAGG 130
            ||||||||||||.|:|.||||.:|||||||||||:|.|.||||||||||.|||:.||::|:||||
Human    66 VKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGG 130

  Fly   131 VELFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVGTVMD 195
            ::||:|||||||||||||||||||||||:||||.||:.|||::||.|:||||..|||||||||||
Human   131 IDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMD 195

  Fly   196 SKEVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHANTLMICDEDATLELRVKTVKYFKGIL 259
            ::|||||||||||||||||||||||||||||||||||..|:.:|||||||||||||||||||::
Human   196 AREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLM 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 195/252 (77%)
GNPDA2NP_612208.1 SugarP_isomerase 1..253 CDD:320918 195/252 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C286487763
eggNOG 1 0.900 E1_COG0363
Hieranoid 1 1.000
Homologene 1 1.000 H12381
Inparanoid 1 1.050 428 1.000 Inparanoid score I1718
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1425290at2759
OrthoFinder 1 1.000 FOG0002194
OrthoInspector 1 1.000 T609928
orthoMCL 1 0.900 OOG5_128189
Panther 1 1.100 O PTHR11280
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2549
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.