DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and KRT75

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_004684.2 Gene:KRT75 HGNCID:24431 Length:551 Species:Homo sapiens

Alignment Length:417 Identity:109/418 (26%)
Similarity:204/418 (49%) Gaps:71/418 (17%)


  Fly    26 AGPQPP--PPS-----THSQTASSPL----SPT-RHSRVAEKVELQNLNDRLATYIDRVRNLETE 78
            :||..|  ||.     |.:|:..:||    .|| :..|..|:.:::.||::.|::||:||.||.:
Human   109 SGPSFPVCPPGGIQEVTVNQSLLTPLHLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQ 173

  Fly    79 NSRLTIEVQTTRDTVTRET-TNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNK 142
            |..|..:....::..:|.. .|::.:|::...|.||.|:....:|.|.|.:::.:.:..|:.|.:
Human   174 NKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVR 238

  Fly   143 LDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLE 207
            .:.:..:.|.||                                          .:|...:|:::
Human   239 YEDEINKRTAAE------------------------------------------NEFVALKKDVD 261

  Fly   208 QETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAK--LKQSLQE 270
            ...:::|:||..::||.||::|...:...|:::    .||:..:....||.:.:..  |...:.|
Human   262 AAYMNKVELEAKVKSLPEEINFIHSVFDAELSQ----LQTQVGDTSVVLSMDNNRNLDLDSIIAE 322

  Fly   271 LRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQA 335
            ::||||:....:|.|.:|.|:.|.:.||..|.|..:....:.:|:......|..|.|.|:.:::.
Human   323 VKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEISEMNRMIQRLRAEIDSVKKQ 387

  Fly   336 NADLNARIRDLERQLDND-RERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAY 399
            .:.|...|.|.|::.:.. ::...:.:| ||:.|.:.:::|.:.|:|||:||:||::||:|||.|
Human   388 CSSLQTAIADAEQRGELALKDARAKLVD-LEEALQKAKQDMARLLREYQELMNIKLALDVEIATY 451

  Fly   400 DKLLVGEEARL--------NITPATNT 418
            .|||.|||.||        ||:..|:|
Human   452 RKLLEGEECRLSGEGVSPVNISVVTST 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 91/359 (25%)
Ax_dynein_light <283..377 CDD:287215 23/95 (24%)
LTD 466..572 CDD:279300
KRT75NP_004684.2 Head 1..148 12/39 (31%)
Keratin_2_head 16..145 CDD:292825 11/36 (31%)
Filament 148..461 CDD:278467 91/360 (25%)
Coil 1A 149..184 12/35 (34%)
Linker 1 185..203 3/18 (17%)
Coil 1B 204..296 23/138 (17%)
Linker 12 297..319 4/22 (18%)
Coil 2 320..458 46/139 (33%)
DUF883 374..>434 CDD:295076 15/61 (25%)
Tail 459..551 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.609 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.