DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and Krt42

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_997648.2 Gene:Krt42 MGIID:1915489 Length:452 Species:Mus musculus

Alignment Length:423 Identity:123/424 (29%)
Similarity:191/424 (45%) Gaps:90/424 (21%)


  Fly    53 AEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDD 117
            :||..:||||||||||:||||.||..|:.|.:::                         |.....
Mouse    93 SEKETMQNLNDRLATYLDRVRALEEANADLEVKI-------------------------REWYKK 132

  Fly   118 TARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLN 182
            .....||   |....::..|:|:||:...|.:..:....:......|::...||......|..:.
Mouse   133 QGPGPAR---DYSPYFKTIEDLRNKILAATIDNASIVLQIDNARLAADDFRTKYETELNLRMSVE 194

  Fly   183 EDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQT 247
            .|:|              ..|:.|::.||:|.|||..|:||:|||::..:.|.:|:|..|     
Mouse   195 ADIN--------------GLRRVLDELTLARADLEMQIESLKEELAYLRKNHEEEMNALR----- 240

  Fly   248 EYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRL-QEAAARTSNS 307
              .::.|.::.|.||    .|.:.|.|:|.|||:..:.||.:.:..:..|.:.| :|.|..|   
Mouse   241 --GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNT--- 300

  Fly   308 THKSIEELRSTRVRIDALNANINELE---QANADLNARIRDLERQLDNDRERHGQE-------ID 362
                 |.|:|:|..|..|..::..||   |:...:.|   .||..|.....|:|.:       |.
Mouse   301 -----EALQSSRTEITELRRSVQNLEIELQSQLSMKA---SLENSLAETEARYGAQLAQLQGLIS 357

  Fly   363 LLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQS 427
            .:|::|..||.:|.:|..|||.|:|:|..|:.|||.|.:||.||:|.|        ||  .:|.|
Mouse   358 SVEQQLCELRCDMERQNHEYQVLLDVKTRLEQEIATYRRLLEGEDAHL--------AT--QYSSS 412

  Fly   428 LRNSTRATPSRRTPSAAVKRKRAVVDESEDHSV 460
            |.:.    |||. .....::.|.:|:|.:|..|
Mouse   413 LASQ----PSRE-GMVTSRQVRTIVEEVQDGKV 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 109/370 (29%)
Ax_dynein_light <283..377 CDD:287215 27/105 (26%)
LTD 466..572 CDD:279300
Krt42NP_997648.2 Head. {ECO:0000255} 4..93 123/424 (29%)
Filament 93..404 CDD:278467 109/371 (29%)
Coil 1A. {ECO:0000255} 94..129 21/60 (35%)
Linker 1. {ECO:0000255} 130..147 3/20 (15%)
Coil 1B. {ECO:0000255} 148..239 28/105 (27%)
FliD_C <236..358 CDD:284583 36/140 (26%)
Linker 12. {ECO:0000255} 240..262 6/29 (21%)
Coil 2. {ECO:0000255} 263..401 49/149 (33%)
Tail. {ECO:0000255} 402..452 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.