DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and NEFM

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_005373.2 Gene:NEFM HGNCID:7734 Length:916 Species:Homo sapiens

Alignment Length:473 Identity:116/474 (24%)
Similarity:216/474 (46%) Gaps:70/474 (15%)


  Fly    41 SSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFE 105
            |.|....:.||..||.:||.||||.|.||::|..||.:|..:..|:|..|...... ..:.:.::
Human    88 SGPGGDYKLSRSNEKEQLQGLNDRFAGYIEKVHYLEQQNKEIEAEIQALRQKQASH-AQLGDAYD 151

  Fly   106 AELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNK 170
            .|:.|.|..|:....::|:.::|...|.|:...||.:.:::.                       
Human   152 QEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEA----------------------- 193

  Fly   171 YNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHS 235
                     :|.:|...|::.|          ||::|:.:|.:|:|:..:|||::|::|....|.
Human   194 ---------RLRDDTEAAIRAL----------RKDIEEASLVKVELDKKVQSLQDEVAFLRSNHE 239

  Fly   236 QEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEA 300
            :|:.:  .:.|.:.|.|...........:..:|:|:|:|.|.....|..:.:..::.:..:|.||
Human   240 EEVAD--LLAQIQASHITVERKDYLKTDISTALKEIRSQLESHSDQNMHQAEEWFKCRYAKLTEA 302

  Fly   301 AARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLE 365
            |.:...:...:.||:...|.::.:.:..:..:......|..::.|:|.:.::|...:...|..||
Human   303 AEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEERHNHDLSSYQDTIQQLE 367

  Fly   366 KELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRN 430
            .||...:.||.:.|:|||||:::|::||:|||||.|||.|||.|.:....:.|..:.:....:..
Human   368 NELRGTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTFAGSITGPLYTHRPPITI 432

  Fly   431 STR-ATPSRRTPSAAVKRK--RAVVDES---EDHSVADYYVSA-----------SAKGNVEIKEI 478
            |:: ..|....|...|:.|  ..:::|:   ::.|..:..::|           ..|...|.||.
Human   433 SSKIQKPKVEAPKLKVQHKFVEEIIEETKVEDEKSEMEEALTAITEELAVSMKEEKKEAAEEKEE 497

  Fly   479 DPEGKFVRLFNKGSEEVA 496
            :||.:        .||||
Human   498 EPEAE--------EEEVA 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 92/355 (26%)
Ax_dynein_light <283..377 CDD:287215 18/94 (19%)
LTD 466..572 CDD:279300 11/43 (26%)
NEFMNP_005373.2 Head 2..104 6/16 (38%)
Filament_head 10..78 CDD:282575
Filament 100..411 CDD:278467 92/356 (26%)
Coil 1A 105..136 15/31 (48%)
Linker 1 137..149 1/13 (8%)
Coil 1B 150..248 27/142 (19%)
Linker 12 249..265 2/16 (13%)
Coil 2A 266..287 6/21 (29%)
Linker 2 288..291 0/3 (0%)
Coil 2B 292..412 39/120 (33%)
Tail 413..916 19/104 (18%)
6 X 13 AA approximate tandem repeats of K-S-P-V-[PS]-K-S-P-V-E-E-[KA]-[GAK] 614..691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.