DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and krt97

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001002383.1 Gene:krt97 ZFINID:ZDB-GENE-040718-78 Length:438 Species:Danio rerio

Alignment Length:441 Identity:118/442 (27%)
Similarity:201/442 (45%) Gaps:99/442 (22%)


  Fly    52 VAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQ---TTRDTVTRETTNIKNIFEAELLETRR 113
            |.||..:||||||||:|:::||:||..|:.|..:::   ..|..|:|:.::    :...:.:.|:
Zfish    77 VNEKTTMQNLNDRLASYLEKVRSLEKANAELERQIREWYDKRTPVSRDYSH----YYVTIEDLRK 137

  Fly   114 LLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADR 178
            .:...::|.||..:.|     :|.:|                       .|.:...||....|.|
Zfish   138 KISVASQDNARIILQI-----DNAKL-----------------------AAEDFRVKYENELALR 174

  Fly   179 KKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRR 243
            ..:..|:              ...||.|:..|::|.|||..|:.|:|||.:..:.|::|: .:.|
Zfish   175 LSVEADI--------------AGLRKVLDDLTMTRSDLEMQIEGLKEELVYLKKNHAEEL-AALR 224

  Fly   244 IKQTEYSEIDGRLSSEYDAKLKQSL----QELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAART 304
            .:.|..|     ::.|.||..:|.|    :|:|.|||...:.|:.|:::.|:.|...|.:..   
Zfish   225 AQMTSSS-----VNVEVDAAPQQDLARIMEEMRQQYEGITEKNKREMEAWYKGKFDELNKQV--- 281

  Fly   305 SNSTHKSIEELRSTRVRIDALNANINELE---QANADLNARIRDLERQLDNDRERHGQE------ 360
              ||.:  |:|..:|..|:.|...:..||   |:...|.:.   ||..|.....|:..:      
Zfish   282 --STRQ--EDLSMSRNEINELRRTLQALEIELQSQLSLKSA---LEGTLGETESRYSIQLNQLQA 339

  Fly   361 -IDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSF 424
             |:.||:||.::|.::.:|..||:.|:|||..|::|||.|.:||.||:.:               
Zfish   340 VINSLEQELTQMRMDIERQASEYKLLLDIKTRLEMEIAEYRRLLDGEDIQ--------------- 389

  Fly   425 SQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEI 475
            .|:::......|.:..| ...||.|.|::|..|..|    ||.:...:||:
Zfish   390 RQTIKVVEVVAPPKPDP-VVTKRVRTVIEEVVDGKV----VSRTEDVDVEV 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 103/372 (28%)
Ax_dynein_light <283..377 CDD:287215 25/104 (24%)
LTD 466..572 CDD:279300 3/11 (27%)
krt97NP_001002383.1 Filament 78..387 CDD:278467 103/371 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.636 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.