DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and KRT19

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_002267.2 Gene:KRT19 HGNCID:6436 Length:400 Species:Homo sapiens

Alignment Length:380 Identity:103/381 (27%)
Similarity:171/381 (45%) Gaps:89/381 (23%)


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDT 118
            ||:.:||||||||:|:|:||.||..|..|.:::   ||...::...                  .
Human    80 EKLTMQNLNDRLASYLDKVRALEAANGELEVKI---RDWYQKQGPG------------------P 123

  Fly   119 ARDRARAEIDIKRLWE-------ENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANA 176
            :||.:.....|:.|.:       ||..:..::|           |.|:   .|::...|:....|
Human   124 SRDYSHYYTTIQDLRDKILGATIENSRIVLQID-----------NARL---AADDFRTKFETEQA 174

  Fly   177 DRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINES 241
            .|..:..|:|              ..|:.|::.||:|.|||..|:.|:|||::..:.|.:||:..
Human   175 LRMSVEADIN--------------GLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTL 225

  Fly   242 RRIKQTEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRL-QEAA 301
            |       .::.|::|.|.|:    .|.:.|.::|:|||...:.||.:.::.:..:.:.| :|.|
Human   226 R-------GQVGGQVSVEVDSAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVA 283

  Fly   302 ARTSNSTHKSIEELRSTRVRIDALNANINELE---QANADLNARIRDLERQLDNDRERHGQE--- 360
            ..|        |:|:.:|..:..|...:..||   |:...:.|.:.|   .|.....|.|.:   
Human   284 GHT--------EQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALED---TLAETEARFGAQLAH 337

  Fly   361 ----IDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLN 411
                |..:|.:|..:|.:..:|.:|||.|||||..|:.|||.|..||.|:|...|
Human   338 IQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYN 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 102/377 (27%)
Ax_dynein_light <283..377 CDD:287215 21/105 (20%)
LTD 466..572 CDD:279300
KRT19NP_002267.2 Head 1..79
Filament 79..390 CDD:278467 102/377 (27%)
Coil 1A 80..115 20/38 (53%)
Linker 1 116..133 2/35 (6%)
Coil 1B 134..225 29/119 (24%)
Linker 12 226..248 6/29 (21%)
Necessary for interaction with PNN. {ECO:0000269|PubMed:10809736} 244..390 46/157 (29%)
Coil 2 249..387 44/149 (30%)
Rod-like helical tail 388..400 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.