DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and KRT17

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_000413.1 Gene:KRT17 HGNCID:6427 Length:432 Species:Homo sapiens

Alignment Length:411 Identity:110/412 (27%)
Similarity:179/412 (43%) Gaps:78/412 (19%)


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDT 118
            ||..:||||||||:|:|:||.||..|:.|.:::   ||...|:                      
Human    84 EKATMQNLNDRLASYLDKVRALEEANTELEVKI---RDWYQRQ---------------------- 123

  Fly   119 ARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNE 183
            |...||   |..:.:...|||:||:...|.:.......:......|::...|:....|.|..:..
Human   124 APGPAR---DYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALRLSVEA 185

  Fly   184 DLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTE 248
            |:|              ..|:.|::.||:|.|||..|::|:|||::..:.|.:|:|..|      
Human   186 DIN--------------GLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALR------ 230

  Fly   249 YSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTH 309
             .::.|.::.|.||    .|.:.|.|:|.|||:..:.||.:.:..:..|.:.|....|..|....
Human   231 -GQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQ 294

  Fly   310 KSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREE 374
            ....|:...|..:.||...:.......|.|...:.:.|.:......:....|..:|::|.:||.|
Human   295 SGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCE 359

  Fly   375 MTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRR 439
            |.||.:||:.|:|:|..|:.|||.|.:||.||:|.|                        |..::
Human   360 MEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHL------------------------TQYKK 400

  Fly   440 TPSAAVKRKRAVVDESEDHSV 460
            .| ...::.|.:|:|.:|..|
Human   401 EP-VTTRQVRTIVEEVQDGKV 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 102/359 (28%)
Ax_dynein_light <283..377 CDD:287215 19/94 (20%)
LTD 466..572 CDD:279300
KRT17NP_000413.1 Head 1..83
Filament 84..394 CDD:278467 102/359 (28%)
Coil 1A 84..120 20/39 (51%)
Peptide epitope S1, induces T-cell and keratinocyte proliferation and IFN-gamma production 102..116 6/14 (43%)
Linker 1 121..138 5/42 (12%)
Coil 1B 139..230 28/105 (27%)
Peptide epitope S2, induces T-cell proliferation and IFN-gamma production 153..167 1/14 (7%)
Zinc_peptidase_like <215..296 CDD:301362 22/88 (25%)
Linker 12 231..250 5/19 (26%)
Coil 2 251..392 42/141 (30%)
Peptide epitope S4, induces T-cell and keratinocyte proliferation and IFN-gamma production 332..346 1/14 (7%)
GrpE <350..>403 CDD:295646 26/78 (33%)
Tail 393..432 9/54 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.