DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and KRT8

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001243211.1 Gene:KRT8 HGNCID:6446 Length:511 Species:Homo sapiens

Alignment Length:467 Identity:128/468 (27%)
Similarity:223/468 (48%) Gaps:98/468 (21%)


  Fly    35 THSQTASSPL----SPTRHS-RVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVT 94
            |.:|:..|||    .|...: |..||.:::.||::.|::||:||.||.:|..|..:....:...|
Human    95 TVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKT 159

  Fly    95 RETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRM 159
            .. :|:.|:||:.:...||.|:...:::.:.|.::..:....|:.|||                 
Human   160 AR-SNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNK----------------- 206

  Fly   160 YESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLR 224
            ||   :|:|.:....|                      :|...:|::::..:::|:||:.::.|.
Human   207 YE---DEINKRTEMEN----------------------EFVLIKKDVDEAYMNKVELESRLEGLT 246

  Fly   225 EELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQS--LQELRAQYEEQMQINRDEIQ 287
            :|::|..|::.:||.|    .|::.|:....||.:....|...  :.|::||||:....:|.|.:
Human   247 DEINFLRQLYEEEIRE----LQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAE 307

  Fly   288 SLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQ-------ANADLNARIRD 345
            |:|:.|.:.||..|.       |..::||.|:..|..:|.||:.|:.       ..|.|.|.|.|
Human   308 SMYQIKYEELQSLAG-------KHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIAD 365

  Fly   346 LERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARL 410
            .|::.:...:....::..||..|.|.:::|.:||:|||:||::|::||:|||.|.|||.|||:||
Human   366 AEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRL 430

  Fly   411 -----NITPATNTA--------------TVQSFSQSLRNS-----TRATPSRRTPSAAVKRKR-- 449
                 |::..|.|.              |....|.||.:|     ..::.||.:.|.||..|:  
Human   431 ESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIE 495

  Fly   450 ----AVVDESED 457
                .:|.||.|
Human   496 TRDGKLVSESSD 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 101/364 (28%)
Ax_dynein_light <283..377 CDD:287215 28/101 (28%)
LTD 466..572 CDD:279300
KRT8NP_001243211.1 Keratin_2_head <91..115 CDD:292825 6/20 (30%)
Filament 118..429 CDD:278467 101/365 (28%)
HAUS2 315..>404 CDD:291664 28/96 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.