DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and LamC

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001260974.1 Gene:LamC FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster

Alignment Length:603 Identity:316/604 (52%)
Similarity:418/604 (69%) Gaps:53/604 (9%)


  Fly     1 MSSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSPTRHSRVAEKVELQNLNDRL 65
            ::::..||.|:||..|.:::.|   .|            |:||.||||.||..||.|||:|||||
  Fly     8 LNTRVSRASTSTPVGGASTSSR---VG------------ATSPTSPTRTSRQQEKEELQHLNDRL 57

  Fly    66 ATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIK 130
            |.||||:||||.||||||.|:...:|||.|||:|:|.::|.||...|:|||:||:::|:.|||||
  Fly    58 ACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIK 122

  Fly   131 RLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERL 195
            ||||||::||.:|||||||.|.||.|.|:||:|.||:|.||||:.|||||..:...|...|.|||
  Fly   123 RLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFEDQAKELALENERL 187

  Fly   196 RKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEY 260
            |:|.::.||.||.|||:||||||..|||||||:||||:|:||:.|:|..:|.|.||||||||.:|
  Fly   188 RRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQY 252

  Fly   261 DAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDAL 325
            :|||:|||||||.|||.||:|||:||:.||:::||.|:.||.|.:..:..:.||:|..|.:||.|
  Fly   253 EAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGL 317

  Fly   326 NANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKV 390
            ||.:..||..||.||||||:||..||.:|:||.|.|..||.||.|:|:||..||:|||.||||||
  Fly   318 NAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKV 382

  Fly   391 SLDLEIAAYDKLLVGEEARLNI----TPATN----------TATVQSFSQSLRNSTRATPSRR-- 439
            |||||||||||||.|||.||||    .|.|:          ||:..|      .|.|.|||.|  
  Fly   383 SLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTASASS------RSGRVTPSGRRS 441

  Fly   440 -TP----SAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGG 499
             ||    |:||||:|.|:|||||.::::|.|:|:|||::||.|.|.||:|::|.|||:||:.:.|
  Fly   442 ATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTG 506

  Fly   500 WQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILL 564
            |||.|:..::  ...:||.|..::.....:|:||.|...:|:||::|||| :||..|::.|::| 
  Fly   507 WQLTRIAGDE--ELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMK-KKWPVANSMRSVL- 567

  Fly   565 NSEGEAVANLDRIKRIVS 582
                   ||.|:..|::|
  Fly   568 -------ANADKEVRVLS 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 222/355 (63%)
Ax_dynein_light <283..377 CDD:287215 47/94 (50%)
LTD 466..572 CDD:279300 41/106 (39%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 222/356 (62%)
ATP-synt_B <67..>142 CDD:304375 47/75 (63%)
MreC <178..>224 CDD:302802 30/46 (65%)
LTD 473..574 CDD:279300 44/112 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131034542
eggNOG 1 0.900 E1_KOG0977
Homologene 1 1.000 H7818
Inparanoid 1 1.050 267 1.000 Inparanoid score I1844
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D204815at33208
OrthoFinder 1 1.000 FOG0000811
orthoMCL 1 0.900 OOG5_128723
Panther 1 1.100 P PTHR45721
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2618
98.920

Return to query results.
Submit another query.