DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and gfap

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_571448.2 Gene:gfap ZFINID:ZDB-GENE-990914-3 Length:444 Species:Danio rerio

Alignment Length:517 Identity:142/518 (27%)
Similarity:230/518 (44%) Gaps:118/518 (23%)


  Fly     2 SSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTHS-----------QTASSPLSPT-------- 47
            ||..:|.||    ||.:     ||.|    ..|.||           ...||||:.:        
Zfish     8 SSYRKRFGT----PGGS-----PSVG----VTSRHSTGRLSLHSSPRHLTSSPLTLSTSRLSLGG 59

  Fly    48 ---------------RHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRET 97
                           |.:|..||||:..||||.|:||::||.||.:|..|..|:...|.   :|.
Zfish    60 ERLDFSADSLLKAQYRETRTNEKVEMMGLNDRFASYIEKVRFLEQQNKMLVAELNQLRG---KEP 121

  Fly    98 TNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYES 162
            :.:.:|::.||.|.||.:|.....:||.||:...|..:...||.:|..:|.....||.|:..:  
Zfish   122 SRLGDIYQEELRELRRQVDGLNAGKARLEIERDNLASDLGTLKQRLQDETALRQEAENNLNTF-- 184

  Fly   163 RANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREEL 227
                                                    |:::::..|:||.||..|::|::|:
Zfish   185 ----------------------------------------RQDVDEAALNRVQLERKIEALQDEI 209

  Fly   228 SFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYED 292
            :|..::|.:|:.|.......:...:|..:|.   ..|..:|:|:|||:|.....|..|.:..|..
Zfish   210 NFLKKVHEEEMRELHEQLMAQQVHVDLDVSK---PDLTAALKEIRAQFEAMANSNMQETEEWYRS 271

  Fly   293 KIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERH 357
            |...|.:||.|...:..::.:|....|.:|..|..::..|..:|..|..:::::|.:...:...:
Zfish   272 KFADLTDAANRNGEALRQAKQEANDYRRQIQGLTCDLESLRGSNESLERQLKEMEERFAIETAGY 336

  Fly   358 GQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQ 422
            ...:..||.|:..|:|||.:.|:|||||:::|::||:|||.|.|||.|||:|:       |..||
Zfish   337 QDTVARLEDEIQMLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRI-------TVPVQ 394

  Fly   423 SFSQSLRNSTRATPSRRTPSAAVKRKRAV-VDESEDHSVADYYVSASAKGNVEIKEIDPEGK 483
            :|: :|:....:..::.||.|.|||...| ..|:.|..:              |||...|.|
Zfish   395 NFT-NLQFRDTSMDTKLTPEAHVKRSIVVRTVETRDGEI--------------IKESTTERK 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 103/355 (29%)
Ax_dynein_light <283..377 CDD:287215 22/94 (23%)
LTD 466..572 CDD:279300 5/19 (26%)
gfapNP_571448.2 Head 1..84 22/89 (25%)
Filament_head 5..79 CDD:282575 19/84 (23%)
Filament 80..388 CDD:278467 103/356 (29%)
Coil 1A 85..116 14/31 (45%)
Linker 1 117..127 2/13 (15%)
Coil 1B 128..226 31/140 (22%)
Linker 12 227..242 2/18 (11%)
Coil 2A 243..264 8/21 (38%)
Linker 2 265..268 0/3 (0%)
Coil 2B 269..389 41/120 (34%)
Tail 390..444 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.630 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.