DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and ifa-4

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_508836.5 Gene:ifa-4 WormBaseID:WBGene00002052 Length:575 Species:Caenorhabditis elegans

Alignment Length:564 Identity:163/565 (29%)
Similarity:266/565 (47%) Gaps:73/565 (13%)


  Fly    45 SPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELL 109
            |..|.||..||.|:..||||||:||::||.||.:|.::..::...|.....::|::|.::|.||.
 Worm    61 SAIRESRTREKKEMSELNDRLASYIEKVRFLEAQNRKMEKDLNLLRGKWGHDSTSVKVMYETELR 125

  Fly   110 ETRRLLDDTARDRARAEIDIKRLWEENEELKNKL-------DKKTKECTTAEGNVRMYESRANEL 167
            ..:.|:.|:.::||:.|..||:|.||....:|||       |...||.....|.:...|:....|
 Worm   126 SAKDLIADSDKERAQLEDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALEAEIELL 190

  Fly   168 NNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQ 232
            ..:.:       .:.|.:....:|..|:.......|..:|||||:|:|.:|.:|:|.||..|..:
 Worm   191 KRRIS-------LMEESIGHLKRENHRMIDSLHHARNAVEQETLNRIDYQNQVQTLLEECDFIRR 248

  Fly   233 IHSQEINE-----SR--RIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLY 290
            ||..||::     ||  .::..||          :..:|..:::|:|::|:......|.:|:|.|
 Worm   249 IHDSEIHDLLAMASRDTTVENREY----------FKNELSSAIREIRSEYDHVSNTTRTDIESWY 303

  Fly   291 EDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRE 355
            :.|:|.:....:|.....:.:.||::..|..:..:...:.:||..|..|..:|.||..|::.|..
 Worm   304 KLKVQEIHTQNSRNCLEQNYAREEVKRLRTTLGDMRGKMADLEGRNLLLEKQIEDLNYQMEEDMR 368

  Fly   356 RHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTAT 420
            .:.|.::..:..:.:||:|....:.|.|.|:|.|.:||.||..|.|:|.|||.|..:        
 Worm   369 SYEQSLNDKDTSINKLRDESKILMVELQMLIDTKQTLDAEIVIYRKMLDGEENRAGL-------- 425

  Fly   421 VQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDPEGKFV 485
                .|.:....:.|...:|..  ::..|.:..|:..||  .|  |.|||||:.|:|.:|.||::
 Worm   426 ----RQLVEQVVKTTSIHQTKE--IESLRVLKGETTSHS--SY--SRSAKGNIAIQEAEPSGKYI 480

  Fly   486 RLFNKGSEEVAIGGWQLQRLINEKGP-------STTYKFHRSVRIEPNGVITVWSADTKASHEPP 543
            .|.|....:..||.|:|:|.|..|..       ..|.:..:||:|...|         :..|.||
 Worm   481 VLENISRRDENIGDWKLRRKIAGKREIVFTFPREFTLRAQKSVKIFARG---------QGVHSPP 536

  Fly   544 SSLVMK-SQKWVSADNTRTILLNSEGEAVANLDRIKRIVSQHTS 586
            .|||.. ...:.:.::..|.|.|.|||     ||...  ||..|
 Worm   537 DSLVYDLEDSFGTGNDVVTTLYNKEGE-----DRASH--SQRAS 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 108/369 (29%)
Ax_dynein_light <283..377 CDD:287215 23/94 (24%)
LTD 466..572 CDD:279300 37/114 (32%)
ifa-4NP_508836.5 Filament 70..422 CDD:278467 108/369 (29%)
DUF342 <135..254 CDD:302792 37/126 (29%)
LTD 463..569 CDD:279300 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7818
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D204815at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128723
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.630 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.