DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lam and Krt36

Sequence 1:NP_001245892.1 Gene:Lam FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001167570.1 Gene:Krt36 MGIID:109364 Length:473 Species:Mus musculus

Alignment Length:496 Identity:126/497 (25%)
Similarity:211/497 (42%) Gaps:104/497 (21%)


  Fly     2 SSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSPTRHS---------------R 51
            |..|.||.:.....|:.|:.|...:||....|.::       ||...||               .
Mouse    33 SMGSCRAPSLVGTVGSVSSFRTGFSGPGSCLPGSY-------LSSGCHSSGFAGSGGWFCEGAFN 90

  Fly    52 VAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRD-TVTRETTNIKNIFE-AELLETRRL 114
            ..||..:|.||||||.|:::||.||.||::|...::...: .:.....:.::.|: ||.|:.:.|
Mouse    91 GNEKATMQILNDRLANYLEKVRQLEQENTQLECRIREWYECQIPYICPDYQSYFKTAEELQQKIL 155

  Fly   115 LDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRK 179
            |..:...|...:||..:|                              .|::...||....:.|:
Mouse   156 LTKSENARLILQIDNAKL------------------------------AADDFRTKYETELSLRQ 190

  Fly   180 KLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRI 244
            .:..|:|              ..|:.|::.||.:.|||..::||:|||....:.|.:|:|..|  
Mouse   191 LVEADIN--------------GLRRILDELTLCKADLEAQVESLKEELLCLKRNHEEEVNALR-- 239

  Fly   245 KQTEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTS 305
                 |::..||:.|.||    .|.:.|.::|.|||..::.||.::::.:..:.:.|.:....:|
Mouse   240 -----SQLGDRLNVEVDAAPPVDLNKILDDMRCQYETLVENNRRDVEAWFNTQTEELNQQVVSSS 299

  Fly   306 NSTHKSIEELRSTRVRIDALNANINELE-QANADLNARIRDLERQLDNDRERHGQE-------ID 362
                   |:|:..:..|..|...:|.|| :..|..:.| ..||..|.....|:..:       |.
Mouse   300 -------EQLQCCQTEIIELRRTVNSLEIELQAQQSMR-NSLESTLAETEARYSSQLGQMQCLIT 356

  Fly   363 LLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQS 427
            .:|.:|..:|.::.:|..|||.|:|:|..|:.|||.|.:||.||:.:|...|. :|....:....
Mouse   357 NVESQLAEIRCDLERQNHEYQVLLDVKARLESEIATYRRLLDGEDCKLPAHPC-STECKPAVRVP 420

  Fly   428 LRNSTRATPSRR-------TPSAAVKRK-RAVVDESEDHSV 460
            ...||..||:..       ||:..|..: |.:.:|..|..|
Mouse   421 YIPSTTCTPAGPCTPAGPCTPAPQVSTQIRTITEEIRDGRV 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 98/369 (27%)
Ax_dynein_light <283..377 CDD:287215 20/102 (20%)
LTD 466..572 CDD:279300
Krt36NP_001167570.1 Head. {ECO:0000255} 1..93 14/67 (21%)
Keratin_2_head 12..>91 CDD:292825 14/65 (22%)
FlbT 90..193 CDD:299726 31/133 (23%)
Filament 92..403 CDD:278467 98/370 (26%)
Coil 1A. {ECO:0000255} 94..128 16/34 (47%)
Linker 1. {ECO:0000255} 129..139 0/10 (0%)
Coil 1B. {ECO:0000255} 140..240 32/151 (21%)
Linker 12. {ECO:0000255} 241..256 5/15 (33%)
RILP-like 246..386 CDD:304877 38/148 (26%)
Coil 2. {ECO:0000255} 257..400 42/151 (28%)
Tail. {ECO:0000255} 401..473 14/63 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.