DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompC and trpc3

DIOPT Version :8

Sequence 1:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster
Sequence 2:NP_001276813.2 Gene:trpc3 / 101887082 ZFINID:ZDB-GENE-140129-1 Length:902 Species:Danio rerio

Alignment Length:979 Identity:219/980 (22%)
Similarity:376/980 (38%) Gaps:271/980 (28%)


  Fly   889 CTEENKAGFTAVHLAAQNGHGQVLDVLKSTNSLRINSKKLGLTP---LHVAAYYGQADTVRELLT 950
            |.:|...|..|.||.:      |..|.:|:...|.|.|.....|   :.:....|:...:|.   
Zfish    24 CWKEENGGVDAHHLKS------VKTVRESSGYYRYNMKSSESFPHRRMTLPREKGRRQAIRG--- 79

  Fly   951 SVPATVKSETPTGQSLFGDLGTESGMTP-----LHLAAFSGNENVVRLLL-NSAGVQVDAATIEN 1009
              ||          .:|...||  .:||     |..|.: ||..|||.:| .|..:.|:.... .
Zfish    80 --PA----------FMFNARGT--SLTPEEERFLDAAEY-GNIPVVRKMLEESLTLNVNCMDY-M 128

  Fly  1010 GYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTG--LHIAAMHGHIQMVEILLG------- 1065
            |.|.|.||....|:.|..|||.|        |...|.|  |.:|...|::::||.|||       
Zfish   129 GQNGLQLAVGNEHLEVTELLLRR--------DNLARVGDALLLAISKGYVRIVEALLGHPSFGNG 185

  Fly  1066 ----------QGAEINATDRNGW------TPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAI 1114
                      |..:..:.|.:|.      ||:..||.....|||.:|...||..:...:|.|...
Zfish   186 ERLTRSPCELQDDDFYSYDEDGTRFSPDITPIILAAHCQKYEVVHMLLLKGARIERPHDYFCKCA 250

  Fly  1115 WFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEF-VLVSPA-------- 1170
              ..:|          .:..|::                 :|:...|..: .|.|||        
Zfish   251 --DCTE----------KQRKDSF-----------------SHSRSRINAYRGLASPAYLSLSSED 286

  Fly  1171 PVDTAAKLSNIYIVLSTKEKERAKDLVAAGKQCEAMATELLALAAGSDSAGKILQATDKRNVE-- 1233
            ||.||.:|||....|:..|||...|......||:.....:|.|...::....||.......:|  
Zfish   287 PVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVSAELEEG 351

  Fly  1234 --------FLDVLIENEQKEVIAHTVVQRYLQELWHGSLT-----WASWKILLLLVAFIVCPPVW 1285
                    .:.:.|:.|.|:.:||...|:.|..:|:.:|:     ..:.|.|::||..:..|.:.
Zfish   352 QHHRSLLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTTAVKCLVVLVVALGLPLLA 416

  Fly  1286 IGFTFPMGHKFNKV---PIIKFMSYLTSHIYLMIHL------SIVGITPI-------YP--VLRL 1332
            :|:.|....|..|:   |.:||:::..|.|..:..|      ...|||.:       :|  :.|:
Zfish   417 VGYWFAPCSKLGKILRSPFMKFVAHAASFIIFLCLLVFNASDRFEGITTLPNVTVTDHPLQIFRV 481

  Fly  1333 SLVPY-WYEVGLLIWLSGLL---------------LFELTNPSDKSGLGSIKVLVLL-------- 1373
            ....: |.|:.:::|::|::               :.:|.|..|   .|.:.:.:..        
Zfish   482 KTTQFSWTEILIMVWVAGMMWSECKELWTEGPREYIMQLWNVLD---FGMLSIFIAAFTARFFAF 543

  Fly  1374 ------------------LGMAGVGVHVSAFLFVSKEYW----PTLVYCRNQCFALAFLLACVQI 1416
                              |.|..:...|..|.: :::.|    |.|:  ....:|:|.:|:..:|
Zfish   544 MQAMKAQKYVDEKIHAPDLSMVTLPPDVRYFTY-ARDKWLPSDPQLI--SEGLYAIAVVLSFSRI 605

  Fly  1417 LDFLSFHHLFGPWAIIIGDLLKDLARFLAVLAIFVF-GFSMHIVALNQSFANFSPEDLRSFEKKN 1480
            ...|..:..|||..|.:|..:||:.:|: ||.|.|| .|.:.:..|...:..         .|.|
Zfish   606 AYILPANESFGPLQISLGRTVKDIFKFM-VLFIMVFLAFMIGMFILYSYYLG---------AKVN 660

  Fly  1481 RNRGYFSDDDMPTPRPPPVENYVDSRFSEFRRKHKDDLRMHPINSFELLFFAVFGQTTTEQTQVD 1545
                         |....||                       .||:.||:::||        :.
Zfish   661 -------------PAFTTVE-----------------------ESFKTLFWSIFG--------LS 681

  Fly  1546 KIKNVATPTQPYWVEYLFKIVFGIYMLVSVVVLINLLIAMMSDTYQRIQAQSDIEWKFGLSKL-I 1609
            ::.:|.......::|.:..:::|||.:..||||:|:||||::.:||.|:..:|:||||..||| :
Zfish   682 EVSSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDADVEWKFARSKLWL 746

  Fly  1610 RNMHRTTTAPSPLNLV---TTWFMWIVEKVKARMKKKKRPSLVQMMGIRQASPRTKAGAKWLSKI 1671
            .......|.|.|.::|   .::::.:...|.....:::|......:|:..:..:       |:..
Zfish   747 SYFDNGKTLPPPFSIVPSPKSFYLCVKRLVNLLRCRRRRLKKDVELGMDNSKSK-------LNLF 804

  Fly  1672 KKDSVALSQVHLSPLGSQASF-SQANQ-NRIENVADWEAIAKKY--RALVGDEEGGSLKDSDAES 1732
            .:.|:.::..|        || |..|| .|.:.:  .:.:.|:|  :|.| |:|...:.:.:.:.
Zfish   805 TQSSMRMTDSH--------SFNSILNQPTRYQQI--MKRLIKRYVLKAQV-DKENDEVNEGELKE 858

  Fly  1733 GSQE 1736
            ..|:
Zfish   859 IKQD 862

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nompCNP_523483.2 ANK repeat 129..157 CDD:293786
Ank_2 131..228 CDD:289560
ANK 155..319 CDD:238125
ANK repeat 159..186 CDD:293786
ANK repeat 232..265 CDD:293786
Ank_2 237..331 CDD:289560
ANK 263..387 CDD:238125
ANK repeat 267..298 CDD:293786
ANK repeat 300..331 CDD:293786
Ank_2 305..398 CDD:289560
ANK 329..454 CDD:238125
ANK repeat 367..398 CDD:293786
ANK repeat 400..431 CDD:293786
Ank_2 405..498 CDD:289560
ANK 428..555 CDD:238125
ANK repeat 433..463 CDD:293786
ANK repeat 469..499 CDD:293786
ANK 496..641 CDD:238125
ANK repeat 501..532 CDD:293786
Ank_2 507..616 CDD:289560
ANK repeat 534..575 CDD:293786
ANK repeat 577..616 CDD:293786
Ank_2 625..722 CDD:289560
ANK 654..780 CDD:238125
ANK repeat 660..690 CDD:293786
ANK repeat 692..723 CDD:293786
Ank_2 697..790 CDD:289560
ANK 720..847 CDD:238125
ANK repeat 725..757 CDD:293786
ANK repeat 759..790 CDD:293786
Ank_5 779..834 CDD:290568
ANK 787..915 CDD:238125 8/26 (31%)
ANK repeat 792..824 CDD:293786
ANK repeat 861..893 CDD:293786 2/4 (50%)
Ank_4 865..915 CDD:290365 8/26 (31%)
Ank_4 929..995 CDD:290365 17/74 (23%)
ANK repeat 932..972 CDD:293786 7/43 (16%)
ANK 969..1096 CDD:238125 46/158 (29%)
ANK repeat 974..1007 CDD:293786 12/39 (31%)
Ank_2 979..1074 CDD:289560 33/115 (29%)
ANK repeat 1009..1041 CDD:293786 11/32 (34%)
ANK 1039..1159 CDD:238125 29/145 (20%)
ANK repeat 1043..1074 CDD:293786 11/50 (22%)
Ank_2 1048..1135 CDD:289560 24/110 (22%)
ANK repeat 1076..1101 CDD:293786 10/31 (32%)
ANK repeat 1109..1134 CDD:293786 3/25 (12%)
Ion_trans <1393..1598 CDD:278921 51/210 (24%)
trpc3NP_001276813.2 trp 78..869 CDD:273311 205/920 (22%)
ANK 101..233 CDD:238125 42/142 (30%)
ANK repeat 128..159 CDD:293786 14/39 (36%)
ANK repeat 206..241 CDD:293786 11/35 (31%)
TRP_2 247..306 CDD:285535 18/88 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.