DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4ac3 and Cyp4d20

Sequence 1:NP_608918.1 Gene:Cyp4ac3 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster

Alignment Length:536 Identity:178/537 (33%)
Similarity:272/537 (51%) Gaps:59/537 (11%)


  Fly     1 MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTR---FGNNLDL 62
            ||:.|:..:|::...|...|            ||.|.     |..:...:||...   .|..|..
  Fly     1 MWLTLITGALILLLTWDFGR------------KRQRV-----LAFEKSAIPGPISIPILGCGLQA 48

  Fly    63 LNLTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDA---EEIFQSTKITTKNMSYELIR 124
            |:|...||..::.|...| .|:.:  .|....| :::..:|.   |.|..||.:..|...||.:|
  Fly    49 LHLGAENIIGWVGEKFDK-YGKTF--RFWILGE-SLIYTKDLQYFETILSSTTLLEKGQLYEYLR 109

  Fly   125 PFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFI----KILDKNVGFELELNQ 185
            |||.||||:|..:|||.|||..|.||||.:|:.::.|....|...:    |:.|....  :::.:
  Fly   110 PFLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTA--VDMLK 172

  Fly   186 IIPQFTLNNICETALGVKLDDMSEGN-EYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGD--YKK 247
            .:....|:.|.|.|:||:::..::.: .|.||:.....:...||......:||.|.|...  :::
  Fly   173 YVSLAALDVITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQ 237

  Fly   248 YSRILRTIHGFSSGIIQRKRQ---------QFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKID 303
            ....:|.:|.|:..:|..:|:         .::...||.. |.|.|.:.|:||.||    :..|:
  Fly   238 LLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDA-EIGSKSQMALLDILL----QSSIN 297

  Fly   304 HQGICD-----EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDL--PEDIDEVSMFQ 361
            :|.:.|     ||:||||.|.||||:.:...|..:|.|.:||:|.:||||.:  |:....|:..|
  Fly   298 NQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQ 362

  Fly   362 FNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQF 426
            ..:|.:|:|||||::||:|..|.|||...:|..:....:|.|..|.:.:|...|||.:||.|..|
  Fly   363 LQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSF 427

  Fly   427 LPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENG 491
            .|||||.:.....:.||:|||||||:|||||||.|||:|||::.|:|.::|||..  |:|.....
  Fly   428 RPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLG--EELKPMLN 490

  Fly   492 IVLRTQQNIKVKFEAR 507
            .:||:...|.|....|
  Fly   491 FILRSASGINVGLRPR 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 167/482 (35%)
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 163/472 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114601269
eggNOG 1 0.900 E2759_KOG0157
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1500
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.