DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp28d1 and Cyp6d4

Sequence 1:NP_608912.1 Gene:Cyp28d1 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_651082.1 Gene:Cyp6d4 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster

Alignment Length:525 Identity:126/526 (24%)
Similarity:255/526 (48%) Gaps:64/526 (12%)


  Fly     8 LFVIAAILALIYVFLTWNFSYWKKRGIPTAK--SWPFVGSFPSVFTQKRNVVYDIDEIYEQYKNT 70
            :.:...:|.|.:.:|..::.||::||.|..|  ..|| |...||:.|::::...|.::|  .|:.
  Fly     5 ILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPF-GCLDSVWRQEKSMGLAIYDVY--VKSK 66

  Fly    71 DSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNPFVLTGEAWKER 135
            :.::|::....|.:::...:.|.::...||.||||..:  :.|.:.||:.| |.|.|.|::|:..
  Fly    67 ERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGV--YVDEERDPLSA-NIFSLRGQSWRSM 128

  Fly   136 RAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQG---LNAKDLCLCYTTEVISDCVL 197
            |..::|..::.::|:.:..|..:..|.|.:::::   .|.:|   ::.|.:...|..::|:..:.
  Fly   129 RHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKE---LPEEGFKEVDIKKVMQNYAIDIIASTIF 190

  Fly   198 GISAQSFTDNP----TPMVGMTK--RVFEQSFGFIFYTVVANLWPPITKFYSVSLFAKDVAAFFY 256
            |:...|| :||    ..:|.:.:  ..|...||.:.:.|     |.|.:|.....|...|.....
  Fly   191 GLDVNSF-ENPDNKFRKLVSLARANNRFNAMFGMMIFLV-----PSIAQFLFRIGFKNPVGLAML 249

  Fly   257 DLMQKCIQVRRESPAAQQRDDFLNYMLQLQ---------EK------------KGLNAAELTSHT 300
            .::::.::.|.:....  |.|.|..::||:         ||            |.::...:|:..
  Fly   250 QIVKETVEYREKHGIV--RKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHIKTISLEAITAQA 312

  Fly   301 MTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEI------GTAELTFEQISELPFTEACIHET 359
            ..|...|.|||......|:..||:.|:...:|::|:      ...::|::.::::.|.:.|:.||
  Fly   313 FIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSLNKMEFLDLCVQET 377

  Fly   360 LRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNIN 424
            :|.:..:....:..|:...:.:.|.|..|   |..|:|.:..:|||.:|:.:|:::.||||   :
  Fly   378 IRKYPGLPILNRECTQDYTVPDTNHVIPK---GTPVVISLYGIHHDAEYFPDPETYDPERF---S 436

  Fly   425 GGAKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEIDDTYFMPA 489
            ..::.|.... |..||:|||||...|......|.|:::|::||:::|  .:|.:.|.:::.....
  Fly   437 EESRNYNPTA-FMPFGEGPRICIAQRMGRINSKLAIIKILQNFNVEV--MSRSEIEFENSGIALI 498

  Fly   490 LKGGV 494
            .|.||
  Fly   499 PKHGV 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 115/480 (24%)
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 108/467 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50964
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1453
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.